PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr7g010020.1
Common NameMTR_7g010020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family HD-ZIP
Protein Properties Length: 273aa    MW: 31182.8 Da    PI: 6.438
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr7g010020.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.72e-1879133256
                      T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      +k+ +++ +q+++Le+ Fe  ++++ e++ +LAk lgL+ rq+ +WFqNrRa+ k
  Medtr7g010020.1  79 KKKIRLNLDQVQALEKSFEFGNKLDPERKVQLAKALGLQPRQIAIWFQNRRARCK 133
                      67888999*********************************************99 PP

2HD-ZIP_I/II120.21.1e-3879171193
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                      +kk rl+ +qv++LE+sFe  +kL+perKv+la++Lglqprq+a+WFqnrRAR ktkqlE++ye+Lk++++a+k+en++L+ ++++L+ el++
  Medtr7g010020.1  79 KKKIRLNLDQVQALEKSFEFGNKLDPERKVQLAKALGLQPRQIAIWFQNRRARCKTKQLENEYEVLKKKFEAVKDENDALKVHNQKLQGELEA 171
                      5999************************************************************************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.7E-2065137IPR009057Homeodomain-like
PROSITE profilePS5007117.23275135IPR001356Homeobox domain
SMARTSM003892.0E-2077139IPR001356Homeobox domain
PfamPF000461.7E-1579133IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.6E-1979133IPR009057Homeodomain-like
CDDcd000863.67E-1779136No hitNo description
PRINTSPR000319.3E-6106115IPR000047Helix-turn-helix motif
PROSITE patternPS000270110133IPR017970Homeobox, conserved site
PRINTSPR000319.3E-6115131IPR000047Helix-turn-helix motif
Gene3DG3DSA:1.20.5.1707.4E-4134173No hitNo description
PfamPF021835.0E-11135175IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MAFPPPHSFM FNPHEDHDQL PSTSLNTFPS FPPQHFQQGA PFLLKKSMSF SGIENKCHDH  60
HEVHGDDELS DDGFQSGEKK KIRLNLDQVQ ALEKSFEFGN KLDPERKVQL AKALGLQPRQ  120
IAIWFQNRRA RCKTKQLENE YEVLKKKFEA VKDENDALKV HNQKLQGELE ALKSKDWCEG  180
GTKYLMKETE GSWSNGSDNS LNINLDLSRT QALNSSVSSQ NGRNLISLLP TSLNPNNIPQ  240
LLQFTSRPDI QDENFSSMFH NIDEHQNLWP WA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1127135RRARCKTKQ
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr7g010020.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1369740.0AC136974.11 Medicago truncatula clone mth2-22e9, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003621170.10.0homeobox-leucine zipper protein ATHB-20
TrEMBLG7KZX60.0G7KZX6_MEDTR; Homeobox leucine zipper ATHB-like protein
STRINGAES773880.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01220.12e-64homeobox protein 20
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]