PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr6g453220.1
Common NameMTR_6g453220
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family G2-like
Protein Properties Length: 509aa    MW: 57223 Da    PI: 9.1868
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr6g453220.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like45.81.4e-143794161755
          G2-like  17 aveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       v+qL G++k + k+ilelm+v+ Lt e+v+SHLQkYRl
  Medtr6g453220.1 379 SVNQL-GIDKVVQKKILELMNVENLTWEKVASHLQKYRL 416
                      79***.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF561123.07E-11154203IPR011009Protein kinase-like domain
PfamPF000695.7E-9154203IPR000719Protein kinase domain
Gene3DG3DSA:1.10.510.108.2E-10165203No hitNo description
SuperFamilySSF482641.23E-14292372IPR001128Cytochrome P450
Gene3DG3DSA:1.10.630.103.2E-16293372IPR001128Cytochrome P450
PfamPF000672.6E-10296370IPR001128Cytochrome P450
SuperFamilySSF466891.97E-9378420IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-16378421IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-12379416IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006468Biological Processprotein phosphorylation
GO:0055114Biological Processoxidation-reduction process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0004672Molecular Functionprotein kinase activity
GO:0005506Molecular Functioniron ion binding
GO:0005524Molecular FunctionATP binding
GO:0016705Molecular Functionoxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0020037Molecular Functionheme binding
Sequence ? help Back to Top
Protein Sequence    Length: 509 aa     Download sequence    Send to blast
MLGKEQEKPA LIPTDAVQKC RLASAKPRLK KTNSQDKLVK NRGSGIPQKI EKLLDPPSGD  60
VAKNISSQNE YGETSDAVTG LVKDQTQFVP AQVITESVVR NWLGVWQTHH VLSTLLVSKI  120
AAIGRMRLKC QIKCGDVFEN KVVDEFNECS YQRRHVCLRN LIWENFTRQF LLGLAYLHSK  180
KTIHREIKGA NLLVDSSGVV KLAEPFLEKA TQWFKVVHTI NFIDILRSFM ISKLQNSQML  240
QSRRVSSWVE LMFAKSDLSL QSAMLRDTRI LVIKWSGHPV KLLAGHGCRG TSFVVETKRS  300
VKENTKNSLM SSYKNEVGGE DRLQLDEIID ECKTIYFAGK DTTSNLFTWG VLLLAEYKEW  360
QSKAHEEIDG SAKEAIEKSV NQLGIDKVVQ KKILELMNVE NLTWEKVASH LQKYRLYLKR  420
VSCVENKEDH MAAALASSSD ASYLRSGVGG HLHTLNGSTL LENKRCNGIW LSRMQEGSLK  480
STCMEVLLSK LEFGVEFFKG GGDCEEAV*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.210853e-61leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr6g453220.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1461271e-58BT146127.1 Medicago truncatula clone JCVI-FLMt-19A22 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A072U9700.0A0A072U970_MEDTR; Cytochrome P450 family protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.18e-15response regulator 12
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]