PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr6g027460.1
Common NameMTR_6g027460
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family Dof
Protein Properties Length: 369aa    MW: 40599.1 Da    PI: 8.2563
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr6g027460.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof116.97.8e-3792151261
           zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                      ++k+++cprC+s +tkfCy+nny+++qPr+fC++C+ryWt+GG++rnv vG+grrknk+ 
  Medtr6g027460.1  92 PDKIVQCPRCKSFDTKFCYFNNYNVNQPRHFCRSCHRYWTNGGTMRNVAVGAGRRKNKHI 151
                      7899******************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-2780149IPR003851Zinc finger, Dof-type
PfamPF027011.8E-3094150IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.02896150IPR003851Zinc finger, Dof-type
PROSITE patternPS01361098134IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MNGEGDMFVK DSSFMLFGKK IPVSDSQIQA NSTTMISCSN SKHKGNDMPH TQIIEKSKNS  60
SNEENESKVN TSIVEDNVET SSTDQDKVLK KPDKIVQCPR CKSFDTKFCY FNNYNVNQPR  120
HFCRSCHRYW TNGGTMRNVA VGAGRRKNKH IASQYRHMIV ASDGIPTASL ETNDSSRYQH  180
GSNLESAAVF RCSNDNGIVL KFGRENASLD ESKGSMLNLM NNRRHVDASG NNCRENGEEE  240
TSLCVSSVTN GHTRGNELFE SEQNRSKPMQ SYPASSWIIP MNQRWNNVTS MVQSSMQMCN  300
PYGIDPTAMQ WCHAPMVAVT NIGLQFVPGS NRNGNVSIGS NGCISPSSST TSNSCISGNG  360
TPILGKHT*
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr6g027460.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013451513.10.0uncharacterized protein LOC25495812
TrEMBLA0A072U8360.0A0A072U836_MEDTR; Dof zinc finger DOF5.2-like protein
STRINGXP_004489646.11e-125(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35023165
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.11e-38cycling DOF factor 3
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]