PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr6g027450.1
Common NameMTR_6g027450
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family Dof
Protein Properties Length: 330aa    MW: 36633.5 Da    PI: 8.1234
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr6g027450.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof114.35.3e-3685144261
           zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                      ++k+++cprC+s +tkfCy+nny++sqPr+fC++C+ryWt+GG +rnvP G+grr+nk+ 
  Medtr6g027450.1  85 PDKIVQCPRCNSFDTKFCYFNNYNVSQPRHFCRKCHRYWTAGGKMRNVPFGAGRRRNKQI 144
                      7899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-2673142IPR003851Zinc finger, Dof-type
PfamPF027019.1E-3187143IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.30789143IPR003851Zinc finger, Dof-type
PROSITE patternPS01361091127IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MNGEGDICVK NFSIMLFGKK IQPNSSTMNS CSNSKHKGNE MPHIQNIEKS KNSSNEENES  60
KVNTSTVEDN METSSTDQDK VLKKPDKIVQ CPRCNSFDTK FCYFNNYNVS QPRHFCRKCH  120
RYWTAGGKMR NVPFGAGRRR NKQIASQYRH MIVASGGIST SNFESNDSST ESAAVFRCSN  180
NNGIVLKFGP ENESNDSIFN PNNHKRNVDA NANNCRENGD EESSLCLSSL TNGYTRGNEL  240
SESEHNRSKP LQNYSASSWM IPLNQSLNNV TSMVQSSMQM CHPYGVDPSS MQWCHMPNIG  300
LQFVPESFKN GSVSIGSNNC ISPSSSTTS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr6g027450.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013451512.10.0dof zinc finger protein DOF1.3
TrEMBLA0A072UI930.0A0A072UI93_MEDTR; Dof zinc finger DOF5.2-like protein
STRINGXP_004489646.11e-105(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35023165
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.21e-37cycling DOF factor 2
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]