PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr6g012450.1
Common NameMTR_6g012450
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family Dof
Protein Properties Length: 496aa    MW: 54380.1 Da    PI: 4.9977
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr6g012450.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.71.2e-38132192262
           zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                      ++k+l+cprC s++tkfCyynny+++qPr+fCk+C+ryWt+GGa+rnvPvG+grrknk+s 
  Medtr6g012450.1 132 PDKILPCPRCYSMDTKFCYYNNYNVNQPRHFCKKCQRYWTAGGAMRNVPVGAGRRKNKNSA 192
                      7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-31120189IPR003851Zinc finger, Dof-type
PfamPF027013.1E-31134190IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.593136190IPR003851Zinc finger, Dof-type
PROSITE patternPS013610138174IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 496 aa     Download sequence    Send to blast
MSEAKDPAIK LFGKTIPVPE IPTGSGDSIG APSSSSGDAV DDGINQNHGS FMDEEEREID  60
EDTMEDESTK CKKEKDEALT QSSEKITDLD TNSRLVEESI NPSTEDEQNT LKTSKIMEEH  120
TENSHDKTLK KPDKILPCPR CYSMDTKFCY YNNYNVNQPR HFCKKCQRYW TAGGAMRNVP  180
VGAGRRKNKN SASHFRQITV PETAVQNSLS DSPNGVHHPS LNCNGTVFTF RTDTPLCESM  240
ESALNLADQG VNISQKNGFI RPEALRIHVP YVGEEKSDEH SIKSSDTSTT LTEDAAASSS  300
VEQVMPNCQS FQPQVPYYPS APWLLPWSPS QWSSQVQPPP AFFPQGFAMP LYPPPAYWGF  360
SMPGAWNNPW LAQPSSPNSA TVNSGPNSPT LGKHSREESM LKPTDSTGSD EGNNKEEKSL  420
WVPKTLRIDD LGEAEKSSIL TTLGIKNDKA DAIRGGGLFK AFASKSNEKD SVQNSPAMQA  480
NPAAMSRSIS FHETS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.223130.0root
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr6g012450.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1667440.0AC166744.12 Medicago truncatula chromosome 6 clone mth2-69h7, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003618507.10.0cyclic dof factor 2
TrEMBLG7KKV40.0G7KKV4_MEDTR; DOF-type zinc finger DNA-binding family protein
STRINGAES747250.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62534147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.22e-92cycling DOF factor 2
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]