PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr6g011610.1
Common NameMTR_6g011610
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family HD-ZIP
Protein Properties Length: 278aa    MW: 31940.5 Da    PI: 6.9588
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr6g011610.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox597.8e-1997149456
                      -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      + +++ eq+++Le+ Fe  +++  e++ +LAk lgL+ rqV +WFqNrRa++k
  Medtr6g011610.1  97 KKRLSLEQVKALEKSFEIGNKLEPERKMQLAKALGLQPRQVAIWFQNRRARWK 149
                      556899**********************************************9 PP

2HD-ZIP_I/II129.71.2e-4195187193
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                      ekk+rls eqvk+LE+sFe  +kLeperK++la++Lglqprqva+WFqnrRAR+ktkqlEk+ye+Lk+++d+lk++n++L++++++L++el++
  Medtr6g011610.1  95 EKKKRLSLEQVKALEKSFEIGNKLEPERKMQLAKALGLQPRQVAIWFQNRRARWKTKQLEKEYEVLKKQFDSLKADNNTLKAQNNKLHAELQT 187
                      69***************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-2079152IPR009057Homeodomain-like
SuperFamilySSF466896.42E-2088153IPR009057Homeodomain-like
PROSITE profilePS5007117.37891151IPR001356Homeobox domain
SMARTSM003891.2E-1894155IPR001356Homeobox domain
CDDcd000863.29E-1696152No hitNo description
PfamPF000465.0E-1697149IPR001356Homeobox domain
PRINTSPR000317.6E-6122131IPR000047Helix-turn-helix motif
PROSITE patternPS000270126149IPR017970Homeobox, conserved site
PRINTSPR000317.6E-6131147IPR000047Helix-turn-helix motif
PfamPF021834.4E-14151190IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MAFPPSHTFI FQTHEDHHHE NILSSSTSLN SYPSFPPHQH FQGSGSNGGA SFMMKRSMSF  60
SGIESNHINT NKCDELVHGD EDQLSDEEGY SQMGEKKKRL SLEQVKALEK SFEIGNKLEP  120
ERKMQLAKAL GLQPRQVAIW FQNRRARWKT KQLEKEYEVL KKQFDSLKAD NNTLKAQNNK  180
LHAELQTLKK RDCFENGTIS LKKENEGSWS NGSDNSSDMN LDLSRTPNSL KPTSMTQLLQ  240
CSSRSDLQDE SFCNMFNNID EQQSLWPWTD HQQHQFR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1143151RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.154230.0flower| root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed predominantly in flowers, and in the cortex of the root and the stem. {ECO:0000269|PubMed:16055682}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr6g011610.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1484820.0BT148482.1 Medicago truncatula clone JCVI-FLMt-17G6 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013450953.10.0homeobox-leucine zipper protein HAT7
SwissprotQ004661e-80HAT7_ARATH; Homeobox-leucine zipper protein HAT7
TrEMBLA0A072U5Q10.0A0A072U5Q1_MEDTR; Homeobox associated leucine zipper protein
STRINGXP_004489381.11e-151(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15150.12e-73homeobox 3
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]