PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr6g011230.1
Common NameMTR_6g011230
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family LBD
Protein Properties Length: 203aa    MW: 22870.2 Da    PI: 7.7354
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr6g011230.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260115.63.1e-3611108198
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      aCa+Ck++rrkC+kdC lapyfpa++p+ f n+h+lFG+sn++k+lk+++ee r+dam+s++ e+++ra+ Pv G++ vi+ +   +++++ el
  Medtr6g011230.1  11 ACASCKFQRRKCSKDCLLAPYFPADKPQVFGNAHRLFGVSNISKILKQVKEEYRDDAMKSIIIESDMRAQFPVGGCLDVIMMYYGMIKNSELEL 104
                      7****************************************************************************************99999 PP

           DUF260  95 allk 98 
                      +++k
  Medtr6g011230.1 105 NSVK 108
                      8876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.03610111IPR004883Lateral organ boundaries, LOB
PfamPF031951.8E-3411107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MNINRGDTSK ACASCKFQRR KCSKDCLLAP YFPADKPQVF GNAHRLFGVS NISKILKQVK  60
EEYRDDAMKS IIIESDMRAQ FPVGGCLDVI MMYYGMIKNS ELELNSVKFL LDHCKQNLEP  120
YLSIHHSSAP SSSTRVPNPY FDTKQHFETN SMDAARVTQL ISGVSNAMEE KSNLMVTQGL  180
CHCEELLDLN GSTKFDLREK EK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-241210612106LOB family transfactor Ramosa2.1
5ly0_B5e-241210612106LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr6g011230.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013450912.11e-151LOB domain-containing protein 22
SwissprotQ9STS63e-31LBD27_ARATH; LOB domain-containing protein 27
TrEMBLA0A072U5L71e-150A0A072U5L7_MEDTR; LOB domain protein
STRINGXP_004497769.15e-47(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44152958
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.11e-33LOB domain-containing protein 27
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]
  2. Kim MJ,Kim M,Kim J
    Combinatorial interactions between LBD10 and LBD27 are essential for male gametophyte development in Arabidopsis.
    Plant Signal Behav, 2015. 10(8): p. e1044193
    [PMID:26252070]
  3. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]