PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr6g005450.1
Common NameMTR_6g005450
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family M-type_MADS
Protein Properties Length: 348aa    MW: 40468.9 Da    PI: 7.9852
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr6g005450.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF40.63.4e-13951143
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                     ++i+ +  r++++  R+ g++ K eELS+LCd++++vi+++++
  Medtr6g005450.1  9 EFIQKEKSRKISLQTRKIGLMTKVEELSILCDVDACVILYAPN 51
                     57999999********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006616.792161IPR002100Transcription factor, MADS-box
SMARTSM004327.3E-10160IPR002100Transcription factor, MADS-box
CDDcd002665.01E-15278No hitNo description
SuperFamilySSF554553.14E-15299IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-6323IPR002100Transcription factor, MADS-box
PfamPF003192.0E-121051IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-62338IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-63859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MGRGRVSVEF IQKEKSRKIS LQTRKIGLMT KVEELSILCD VDACVILYAP NFEGQGYDEP  60
ETWPKDTKEL QRILQRYYNT TIDRRLKTYN VQEYFKERMK KVEFEISKVR KEKFKMKYQT  120
WDESFNFLED EQLRLFASIL DFKLDACNLK MNMLKGDLRG KSIALETNKI DNLNSSPYLD  180
SNPSSYFNLP QNNMSQAHIY PPLMNINDKN PLGFWPLISG QSSQPSHMVS TAQSSQPSPM  240
VSSAQSFYHV ESYPCKQIDG NWTHHVDGNV TYHHPKIDMK KDEAENDKIL PPYYYNRNGM  300
IMQSYPIAMS TLPSQNLSNL SHEHLNNGSY DKDVLHTQMF NYMDGRK*
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr6g005450.1
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1465600.0AC146560.21 Medicago truncatula chromosome 6 clone mth2-12g6, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003618177.10.0agamous-like MADS-box protein AGL82
TrEMBLG7KHI30.0G7KHI3_MEDTR; MADS-box transcription factor family protein
STRINGAES743950.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.11e-23M-type_MADS family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]