PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr6g005440.1
Common NameMTR_6g005440
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family M-type_MADS
Protein Properties Length: 316aa    MW: 36992.4 Da    PI: 9.6576
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr6g005440.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF54.21.8e-171151343
                     --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
           SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                     i+ ++ r++t+ kR+ g++KKA+E S+LCd++v++i+++++
  Medtr6g005440.1 11 IQKERSRKITLQKRKDGLIKKAKEFSILCDVDVCLILYAPN 51
                     788999********************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006620.381161IPR002100Transcription factor, MADS-box
SMARTSM004327.1E-19160IPR002100Transcription factor, MADS-box
CDDcd002663.21E-20279No hitNo description
SuperFamilySSF554557.06E-20298IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-12323IPR002100Transcription factor, MADS-box
PfamPF003192.8E-171151IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-122338IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-123859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MGRGRISMEL IQKERSRKIT LQKRKDGLIK KAKEFSILCD VDVCLILYAP NLEGQGYIEP  60
ETWPKDKREV QRVLQKYYET TIDRRPKTYD VQEYFKERMK KVELEIYKVR KERLKMKYPT  120
WDESYNSFGN EQLRSFVRFL DSKLDACDQK MNMRKDESYK VNNLISSPYL TSNSGTNFNL  180
MHTNISQVKI YSPLMNICDK NPLGFWPIRL GQSSQHSLMV SSAQSSYYYP SKHIDANVTY  240
DSKISMKKKD EVKNDKNLPS YYYNGNAMIM QSYPIAMPTP PFQNLANLSH EYLLYGSYDI  300
DSIQAQLFNS KNGTK*
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr6g005440.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1465600.0AC146560.21 Medicago truncatula chromosome 6 clone mth2-12g6, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003618176.10.0agamous-like MADS-box protein AGL17
TrEMBLG7KHI20.0G7KHI2_MEDTR; MADS-box transcription factor family protein
STRINGAES743940.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.18e-27M-type_MADS family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]