PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr6g005080.1
Common NameMTR_6g005080
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family LBD
Protein Properties Length: 143aa    MW: 15838.9 Da    PI: 6.7742
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr6g005080.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.32.6e-4310108199
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrrkC++dC++apyfp e+p+kf nvhk+FGasnv+k+l+++ +++red+++sl+yeAear+++PvyG+vg i+ lq ql +l++el
  Medtr6g005080.1  10 PCAACKFLRRKCNQDCIFAPYFPPEEPHKFVNVHKIFGASNVSKILNEVLPHQREDTVNSLAYEAEARIKNPVYGCVGAISVLQGQLFRLQKEL 103
                      7********************************************************************************************* PP

           DUF260  95 allke 99 
                      +++++
  Medtr6g005080.1 104 DATNA 108
                      99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.4379110IPR004883Lateral organ boundaries, LOB
PfamPF031951.9E-4210107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 143 aa     Download sequence    Send to blast
MMASGYSNSP CAACKFLRRK CNQDCIFAPY FPPEEPHKFV NVHKIFGASN VSKILNEVLP  60
HQREDTVNSL AYEAEARIKN PVYGCVGAIS VLQGQLFRLQ KELDATNADL IRFTHEGSSS  120
LGLGHVHSDD FFNYPSNLSN DM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-5871148115LOB family transfactor Ramosa2.1
5ly0_B2e-5871148115LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr6g005080.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1743420.0AC174342.16 Medicago truncatula chromosome 6 clone mth2-166e17, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003618148.31e-104LOB domain-containing protein 25
SwissprotQ8L8Q31e-64LBD25_ARATH; LOB domain-containing protein 25
TrEMBLA0A396HAP91e-104A0A396HAP9_MEDTR; Putative transcription factor AS2-LOB family
STRINGAES743661e-102(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF109134112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.17e-67LOB domain-containing protein 25
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]
  2. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]