PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr5g095900.1
Common NameMTR_5g095900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family NF-YB
Protein Properties Length: 184aa    MW: 20268.5 Da    PI: 4.3534
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr5g095900.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB100.71.1e-3116105392
            NF-YB   3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 
                      e  r +Pianv r+mkk+lP +aki++++ke++ + ++efisfvt+ea++ c+ + r ti+++dll ++ +lGf+dy++    y++ +r+
  Medtr5g095900.1  16 EFSRAFPIANVHRLMKKALPRHAKITDESKEIMVKYAAEFISFVTAEANHYCKLDCRTTITAEDLLATMQKLGFDDYAQYSFRYIQLFRH 105
                      557999********************************************************************************9996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.2E-2915105IPR009072Histone-fold
SuperFamilySSF471137.26E-2419104IPR009072Histone-fold
PfamPF008085.8E-172082IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MLEDGVQPAS SRVQEEFSRA FPIANVHRLM KKALPRHAKI TDESKEIMVK YAAEFISFVT  60
AEANHYCKLD CRTTITAEDL LATMQKLGFD DYAQYSFRYI QLFRHGARVG QYAPPPPPPP  120
PPPQDFQAHN FPLDPNSVLT DPTEMGAILG DDDDEDRELG GGGGDGNSSD GSFDVMAFLN  180
NDD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5g49_A1e-24191041196NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr5g095900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCR9317420.0CR931742.2 Medicago truncatula chromosome 5 clone mth2-28i20, COMPLETE SEQUENCE.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024639803.11e-132nuclear transcription factor Y subunit B-3
TrEMBLG7KEG51e-133G7KEG5_MEDTR; Core histone H2A/H2B/H3/H4
STRINGAET007861e-132(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2119923
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.21e-26nuclear factor Y, subunit B6
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]