PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr5g093010.1
Common NameMTR_5g093010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family LBD
Protein Properties Length: 146aa    MW: 16601.8 Da    PI: 8.6659
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr5g093010.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260122.22.8e-3851051101
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk +rr+C++dC+++pyfpa++p++fa vhk++G  nv k+l++lp+  re+a+++l+ eA++r+++PvyG+vg+i+kl qq++ ++ael
  Medtr5g093010.1   5 RCAACKSQRRRCPSDCIFSPYFPANNPQRFASVHKIYGGGNVGKMLQQLPHYVREQAANTLYLEAQCRIQNPVYGCVGIISKLYQQIHDTEAEL 98 
                      6********************************************************************************************* PP

           DUF260  95 allkeel 101
                      a++++++
  Medtr5g093010.1  99 AKIQTQI 105
                      **99885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.664105IPR004883Lateral organ boundaries, LOB
PfamPF031954.3E-385102IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
MIYGRCAACK SQRRRCPSDC IFSPYFPANN PQRFASVHKI YGGGNVGKML QQLPHYVREQ  60
AANTLYLEAQ CRIQNPVYGC VGIISKLYQQ IHDTEAELAK IQTQIACHKL QNQQYEAGSN  120
FNLLPPQSSS MEQFQWPNQT PNWFN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-33611012119LOB family transfactor Ramosa2.1
5ly0_B2e-33611012119LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr5g093010.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU1798941e-160CU179894.1 Medicago truncatula chromosome 5 clone mth4-21m22, COMPLETE SEQUENCE.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003617566.11e-106LOB domain-containing protein 24
SwissprotP594675e-45LBD23_ARATH; LOB domain-containing protein 23
SwissprotP594685e-45LBD24_ARATH; LOB domain-containing protein 24
TrEMBLG7K3J31e-104G7K3J3_MEDTR; Lateral organ boundaries (LOB) domain protein
STRINGAET005251e-105(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36973066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.12e-47LOB domain-containing protein 24
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]