PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr5g083960.1
Common NameMTR_5g083960
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family LBD
Protein Properties Length: 197aa    MW: 21826.7 Da    PI: 7.4062
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr5g083960.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260129.91.1e-40391381100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+kll ++pe++r da++slvyeA++r+rdPvyG++g i++lqqq+++l  el
  Medtr5g083960.1  39 PCAACKLLRRRCAQECPFSPYFSPHEPQKFASVHKVFGASNVSKLLLEVPENQRADAANSLVYEANVRLRDPVYGCMGAISSLQQQVQSLIGEL 132
                      7******************************************************************************************999 PP

           DUF260  95 allkee 100
                      ++++ee
  Medtr5g083960.1 133 NAIREE 138
                      999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.12338139IPR004883Lateral organ boundaries, LOB
PfamPF031951.7E-4039136IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MSRERGRFFD EIGKKREGDE SFQKGRMLGP SGTLNTTTPC AACKLLRRRC AQECPFSPYF  60
SPHEPQKFAS VHKVFGASNV SKLLLEVPEN QRADAANSLV YEANVRLRDP VYGCMGAISS  120
LQQQVQSLIG ELNAIREEIH KYKLMEANML PSSEDVSIAT LPPSTSLPML PSSIYTQQTN  180
PTSYSSISND HISYFD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-45331595131LOB family transfactor Ramosa2.1
5ly0_B2e-45331595131LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr5g083960.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCR9387100.0CR938710.1 Medicago truncatula chromosome 5 clone mth2-170k9, COMPLETE SEQUENCE.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003616758.11e-145LOB domain-containing protein 15
SwissprotQ8L5T53e-70LBD15_ARATH; LOB domain-containing protein 15
TrEMBLG7KH281e-144G7KH28_MEDTR; LOB domain protein
STRINGAES997161e-145(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22983486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.12e-71LOB domain-containing protein 15
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]
  2. Ohashi-Ito K,Iwamoto K,Fukuda H
    LOB DOMAIN-CONTAINING PROTEIN 15 Positively Regulates Expression of VND7, a Master Regulator of Tracheary Elements.
    Plant Cell Physiol., 2018. 59(5): p. 989-996
    [PMID:29444288]