PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr5g083230.1
Common NameMTR_5g083230
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family LBD
Protein Properties Length: 168aa    MW: 18806.3 Da    PI: 7.0001
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr5g083230.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260141.92e-4461051100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +Ca+Ck+lrr+C+kdC++apyfp+++p+kfa+vhk+FGasnv+k+l++lp ++r da++slvyeA+ar+rdPvyG+vg i+ lq+q+++l+ +l
  Medtr5g083230.1   6 PCASCKLLRRRCTKDCTFAPYFPSHEPQKFAIVHKVFGASNVSKMLQELPVHQRADAVNSLVYEANARVRDPVYGCVGAISYLQNQVSELQMQL 99 
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      a++++e
  Medtr5g083230.1 100 AVAQAE 105
                      *99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.5115106IPR004883Lateral organ boundaries, LOB
PfamPF031953.3E-446103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MGGNSPCASC KLLRRRCTKD CTFAPYFPSH EPQKFAIVHK VFGASNVSKM LQELPVHQRA  60
DAVNSLVYEA NARVRDPVYG CVGAISYLQN QVSELQMQLA VAQAEILCIQ MQNEQVIPTP  120
QINQDQKSYY IQDELTQYLN YGSSSSNNVI HDSLKRENNM YGHDMVS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU3023350.0CU302335.1 Medicago truncatula chromosome 5 clone mth2-155g22, COMPLETE SEQUENCE.
GenBankCR9541980.0CR954198.2 Medicago truncatula chromosome 5 clone mte1-67f21, COMPLETE SEQUENCE.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003616690.11e-123lateral organ boundaries (LOB) domain protein
SwissprotQ8LBW33e-74LBD12_ARATH; LOB domain-containing protein 12
TrEMBLG7K2881e-123G7K288_MEDTR; Lateral organ boundaries (LOB) domain protein
STRINGGLYMA18G02780.13e-93(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.12e-75LBD family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]