PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr5g083230.1
Common NameMTR_5g083230
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family LBD
Protein Properties Length: 168aa    MW: 18806.3 Da    PI: 7.0001
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr5g083230.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260141.92e-4461051100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +Ca+Ck+lrr+C+kdC++apyfp+++p+kfa+vhk+FGasnv+k+l++lp ++r da++slvyeA+ar+rdPvyG+vg i+ lq+q+++l+ +l
  Medtr5g083230.1   6 PCASCKLLRRRCTKDCTFAPYFPSHEPQKFAIVHKVFGASNVSKMLQELPVHQRADAVNSLVYEANARVRDPVYGCVGAISYLQNQVSELQMQL 99 
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      a++++e
  Medtr5g083230.1 100 AVAQAE 105
                      *99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.5115106IPR004883Lateral organ boundaries, LOB
PfamPF031953.3E-446103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MGGNSPCASC KLLRRRCTKD CTFAPYFPSH EPQKFAIVHK VFGASNVSKM LQELPVHQRA  60
DAVNSLVYEA NARVRDPVYG CVGAISYLQN QVSELQMQLA VAQAEILCIQ MQNEQVIPTP  120
QINQDQKSYY IQDELTQYLN YGSSSSNNVI HDSLKRENNM YGHDMVS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A9e-5021197124LOB family transfactor Ramosa2.1
5ly0_B9e-5021197124LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed predominantly in roots, and at low levels in shoots, floral stems and open flowers. {ECO:0000269|PubMed:12068116}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr5g083230.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCR9541980.0CR954198.2 Medicago truncatula chromosome 5 clone mte1-67f21, COMPLETE SEQUENCE.
GenBankCU3023350.0CU302335.1 Medicago truncatula chromosome 5 clone mth2-155g22, COMPLETE SEQUENCE.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003616690.11e-123LOB domain-containing protein 12
SwissprotQ8LBW34e-73LBD12_ARATH; LOB domain-containing protein 12
TrEMBLG7K2881e-122G7K288_MEDTR; Lateral organ boundaries (LOB) domain protein
STRINGAES996481e-123(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.12e-75LBD family protein
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]
  2. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]