PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr5g083010.1
Common NameMTR_5g083010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family LBD
Protein Properties Length: 178aa    MW: 19801.5 Da    PI: 7.2432
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr5g083010.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260126.71.1e-39111101100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+l+r+C ++C++apyf +++ kkfa vhk+FGasnv+k+l ++pee+re++++sl+yeA+ar+rdPvyG++g i  lq+++ +l+++l
  Medtr5g083010.1  11 SCAACKFLKRRCIPNCIFAPYFRSDECKKFAKVHKVFGASNVSKILIEVPEEQREETVNSLAYEADARLRDPVYGCIGAIALLQRKMVELQHDL 104
                      6********************************************************************************************* PP

           DUF260  95 allkee 100
                      a +k++
  Medtr5g083010.1 105 AIAKDR 110
                      999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.33110111IPR004883Lateral organ boundaries, LOB
PfamPF031958.1E-3911108IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
MKGYEPRSSS SCAACKFLKR RCIPNCIFAP YFRSDECKKF AKVHKVFGAS NVSKILIEVP  60
EEQREETVNS LAYEADARLR DPVYGCIGAI ALLQRKMVEL QHDLAIAKDR LARCAAAAAT  120
PTSSFSNDMM NSNVSLPPFP EFFTCSDFSD NLSHSSSSQS FTRNETVDDF VQIPYIF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-4561236125LOB family transfactor Ramosa2.1
5ly0_B1e-4561236125LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr5g083010.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1447290.0AC144729.29 Medicago truncatula clone mth2-15j6, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003616672.11e-129LOB domain-containing protein 21
SwissprotQ9SRL82e-62LBD21_ARATH; LOB domain-containing protein 21
TrEMBLG7K2701e-128G7K270_MEDTR; Lateral organ boundaries (LOB) domain protein
STRINGAES996301e-128(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59443353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11090.14e-61LOB domain-containing protein 21
Publications ? help Back to Top
  1. Weber AP,Weber KL,Carr K,Wilkerson C,Ohlrogge JB
    Sampling the Arabidopsis transcriptome with massively parallel pyrosequencing.
    Plant Physiol., 2007. 144(1): p. 32-42
    [PMID:17351049]
  2. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]