PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr5g075380.1
Common NameMTR_5g075380
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family M-type_MADS
Protein Properties Length: 163aa    MW: 19122.4 Da    PI: 9.9279
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr5g075380.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF36.28e-121051243
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                     +i n++ r  t+ kR + ++KK +E+ +LC+++++ i+f ++
  Medtr5g075380.1 10 FITNHTARRATYKKRVQSLMKKLNEITTLCGVKACGIVFKPD 51
                     899**********************************99776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004326.0E-13160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006613.231148IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.88E-19495IPR002100Transcription factor, MADS-box
CDDcd002661.86E-18483No hitNo description
PfamPF003194.7E-131051IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MAGKKVKLAF ITNHTARRAT YKKRVQSLMK KLNEITTLCG VKACGIVFKP DDLEPQIWPS  60
IEGVHSVLVR FMQTPNFDRD RKMFDHESYL KERIQKLNEK LKKKMKENRM MWMSVQLHHY  120
LEAGNVPEDL STSDMNDLTY VVDEKMKEIN MKMVQLEKDE RS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCR9621330.0CR962133.1 Medicago truncatula chromosome 5 clone mth2-17h8, COMPLETE SEQUENCE.
GenBankAC1419230.0AC141923.27 Medicago truncatula clone mth2-7f19, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003616031.11e-119MADS-box transcription factor family protein
TrEMBLG7K0T41e-119G7K0T4_MEDTR; MADS-box transcription factor family protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45233154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.12e-29AGAMOUS-like 80
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]