PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr5g075020.2
Common NameMTR_5g075020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family LBD
Protein Properties Length: 231aa    MW: 24832.2 Da    PI: 8.7052
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr5g075020.2genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260132.12.3e-41431421100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vhk+FGasnv+kll ++pe +r da++s+vyeA+ r+rdPvyG++g i++lqqq+++l+ael
  Medtr5g075020.2  43 PCAACKLLRRRCAEECPFSPYFSPHEPQKFAAVHKVFGASNVSKLLLEVPEGQRADAANSMVYEANLRLRDPVYGCMGAISSLQQQVQSLQAEL 136
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      +++++e
  Medtr5g075020.2 137 HAVRTE 142
                      *99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.18942143IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-4143140IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MSRDSGRLDE IAKINSEGET SSQMGRKHLY GPTSGTTLNT VTPCAACKLL RRRCAEECPF  60
SPYFSPHEPQ KFAAVHKVFG ASNVSKLLLE VPEGQRADAA NSMVYEANLR LRDPVYGCMG  120
AISSLQQQVQ SLQAELHAVR TELLKYKYRE AASFISSQVS MPTSANSQPL PLPTTLAPPS  180
PAPPPPQKVL ASQSIILSSL SSSSTSSVYT PPKTTMSHGS ISSENIPYFV *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-46361504118LOB family transfactor Ramosa2.1
5ly0_B7e-46361504118LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.255390.0root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in shoots and roots and at low levels in flowers, but not in leaves or inflorescence stems. {ECO:0000269|PubMed:12068116}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr5g075020.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1438890.0BT143889.1 Medicago truncatula clone JCVI-FLMt-13L16 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003616000.11e-168LOB domain-containing protein 13 isoform X2
SwissprotQ9AT612e-72LBD13_ARATH; LOB domain-containing protein 13
TrEMBLG7KFM71e-167G7KFM7_MEDTR; LOB domain protein
STRINGAES989571e-162(Medicago truncatula)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.12e-67LOB domain-containing protein 15
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]
  2. Cho C,Jeon E,Pandey SK,Ha SH,Kim J
    LBD13 positively regulates lateral root formation in Arabidopsis.
    Planta, 2019. 249(4): p. 1251-1258
    [PMID:30627888]