PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr5g075020.1
Common NameMTR_5g075020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family LBD
Protein Properties Length: 235aa    MW: 25263.8 Da    PI: 8.1201
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr5g075020.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260132.12.4e-41471461100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vhk+FGasnv+kll ++pe +r da++s+vyeA+ r+rdPvyG++g i++lqqq+++l+ael
  Medtr5g075020.1  47 PCAACKLLRRRCAEECPFSPYFSPHEPQKFAAVHKVFGASNVSKLLLEVPEGQRADAANSMVYEANLRLRDPVYGCMGAISSLQQQVQSLQAEL 140
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      +++++e
  Medtr5g075020.1 141 HAVRTE 146
                      *99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.18946147IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-4147144IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MFGCPETVAE RLDEIAKINS EGETSSQMGR KHLYGPTSGT TLNTVTPCAA CKLLRRRCAE  60
ECPFSPYFSP HEPQKFAAVH KVFGASNVSK LLLEVPEGQR ADAANSMVYE ANLRLRDPVY  120
GCMGAISSLQ QQVQSLQAEL HAVRTELLKY KYREAASFIS SQVSMPTSAN SQPLPLPTTL  180
APPSPAPPPP QKVLASQSII LSSLSSSSTS SVYTPPKTTM SHGSISSENI PYFV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-45401544118LOB family transfactor Ramosa2.1
5ly0_B1e-45401544118LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.255390.0root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in shoots and roots and at low levels in flowers, but not in leaves or inflorescence stems. {ECO:0000269|PubMed:12068116}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr5g075020.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1438890.0BT143889.1 Medicago truncatula clone JCVI-FLMt-13L16 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003615999.11e-171LOB domain-containing protein 13 isoform X1
SwissprotQ9AT611e-72LBD13_ARATH; LOB domain-containing protein 13
TrEMBLG7KFM61e-170G7KFM6_MEDTR; LOB domain protein
STRINGAES989571e-171(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22983486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.19e-67LOB domain-containing protein 13
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]
  2. Cho C,Jeon E,Pandey SK,Ha SH,Kim J
    LBD13 positively regulates lateral root formation in Arabidopsis.
    Planta, 2019. 249(4): p. 1251-1258
    [PMID:30627888]