PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr5g066960.1
Common NameMTR_5g066960
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family M-type_MADS
Protein Properties Length: 62aa    MW: 6878.05 Da    PI: 11.3251
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr5g066960.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF85.92.3e-271059251
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     ri+n++ rqvtfskRrng+lKKA+EL +LCdaev v+ifsst kly+++s
  Medtr5g066960.1 10 RIDNSTSRQVTFSKRRNGLLKKAKELAILCDAEVGVMIFSSTAKLYDFAS 59
                     8***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.511161IPR002100Transcription factor, MADS-box
SMARTSM004328.1E-39160IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.76E-28260IPR002100Transcription factor, MADS-box
CDDcd002652.51E-36260No hitNo description
PRINTSPR004046.5E-29323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003193.7E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004046.5E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004046.5E-293859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 62 aa     Download sequence    Send to blast
MGRGKIQIRR IDNSTSRQVT FSKRRNGLLK KAKELAILCD AEVGVMIFSS TAKLYDFAST  60
R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A3e-19260159MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B3e-19260159MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C3e-19260159MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D3e-19260159MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1tqe_R4e-19160160Myocyte-specific enhancer factor 2B
1tqe_S4e-19160160Myocyte-specific enhancer factor 2B
3kov_A4e-19260159Myocyte-specific enhancer factor 2A
3kov_B4e-19260159Myocyte-specific enhancer factor 2A
3kov_I4e-19260159Myocyte-specific enhancer factor 2A
3kov_J4e-19260159Myocyte-specific enhancer factor 2A
3mu6_A3e-19260159Myocyte-specific enhancer factor 2A
3mu6_B3e-19260159Myocyte-specific enhancer factor 2A
3mu6_C3e-19260159Myocyte-specific enhancer factor 2A
3mu6_D3e-19260159Myocyte-specific enhancer factor 2A
3p57_A4e-19260159Myocyte-specific enhancer factor 2A
3p57_B4e-19260159Myocyte-specific enhancer factor 2A
3p57_C4e-19260159Myocyte-specific enhancer factor 2A
3p57_D4e-19260159Myocyte-specific enhancer factor 2A
3p57_I4e-19260159Myocyte-specific enhancer factor 2A
3p57_J4e-19260159Myocyte-specific enhancer factor 2A
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.157201e-100root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT4857952e-99CT485795.2 Medicago truncatula chromosome 5 clone mte1-33h11, COMPLETE SEQUENCE.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003615358.21e-37MADS-box transcription factor family protein
SwissprotQ9SI381e-32ANR1_ARATH; MADS-box transcription factor ANR1
TrEMBLG7JYJ61e-37G7JYJ6_MEDTR; MADS-box transcription factor family protein
STRINGPOPTR_0005s19440.12e-33(Populus trichocarpa)
STRINGSolyc12g088080.1.11e-33(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G14210.17e-34AGAMOUS-like 44
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]