PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr5g053390.1
Common NameMTR_5g053390
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family M-type_MADS
Protein Properties Length: 238aa    MW: 26533.2 Da    PI: 7.1978
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr5g053390.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF663.8e-211764249
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                     + +n+s  qvtfskRr g++KKA+EL+ LC+a va+iifs++ k++ +
  Medtr5g053390.1 17 KMSNESSLQVTFSKRRSGLFKKASELCSLCGAYVALIIFSPSEKVFSF 64
                     6799****************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006624.418868IPR002100Transcription factor, MADS-box
SMARTSM004328.2E-31867IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.27E-26981IPR002100Transcription factor, MADS-box
CDDcd002651.13E-34977No hitNo description
PRINTSPR004041.8E-181030IPR002100Transcription factor, MADS-box
PfamPF003197.6E-231864IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-183045IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-184566IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MSSGKKTRGR QKIEMKKMSN ESSLQVTFSK RRSGLFKKAS ELCSLCGAYV ALIIFSPSEK  60
VFSFGHPNVE TVIDHYLSQV LPQNDDIMKI IGDDRNTVVS ELNAVLTRIK DELDIEKNRG  120
NELSQPQKKN LAQFWWNCPI DGMDMVQLES FKKALEDLKK LVAQHADRVE MQGTSTQPLQ  180
VFEGNGSSSN MPLKHQPDPQ QDSIFPAEFI QNPMLQPHLF GFNNMGGEGG HGPHGLS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU9141270.0CU914127.2 Medicago truncatula chromosome 5 clone mth2-44c3, COMPLETE SEQUENCE.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003614417.11e-178MADS-box transcription factor family protein
SwissprotQ9FKK21e-53AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBLG7JX341e-178G7JX34_MEDTR; MADS-box transcription factor family protein
STRINGGLYMA20G27330.19e-80(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.19e-55AGAMOUS-like 62
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]