PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr5g047580.1
Common NameMTR_5g047580
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family M-type_MADS
Protein Properties Length: 157aa    MW: 17998.9 Da    PI: 10.251
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr5g047580.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF45.21.2e-141048240
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviif 40
                     +i+n+s r+ t+ kR++gi+KK  EL +LC++ ++ ii 
  Medtr5g047580.1 10 FISNDSARKATYNKRKKGIIKKVRELTILCGIPACAIIS 48
                     8**********************************9984 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.1E-19160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.217147IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.23E-21183IPR002100Transcription factor, MADS-box
CDDcd002664.10E-21284No hitNo description
PRINTSPR004046.1E-8323IPR002100Transcription factor, MADS-box
PfamPF003192.6E-141050IPR002100Transcription factor, MADS-box
PRINTSPR004046.1E-82338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    Send to blast
MTRKKVKLAF ISNDSARKAT YNKRKKGIIK KVRELTILCG IPACAIISNP FSSKTEVWPD  60
LEGARQVIER YQNSSVKDET KNMNQESFLL QRITKAREQL QKQSHDSREK ELNNLMIGCM  120
KNRKLPDELS VSELKDFDKL IEKILKDMDN KIDALG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU3023420.0CU302342.2 Medicago truncatula chromosome 5 clone mth2-58n22, COMPLETE SEQUENCE.
GenBankCT8637120.0CT863712.2 Medicago truncatula chromosome 5 clone mte1-56h5, COMPLETE SEQUENCE.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003614286.11e-111MADS-box transcription factor family protein
TrEMBLG7JY851e-111G7JY85_MEDTR; MADS-box transcription factor family protein
STRINGGLYMA10G28320.13e-53(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13237929
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26630.12e-42M-type_MADS family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]