PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr5g046870.1
Common NameMTR_5g046870
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family M-type_MADS
Protein Properties Length: 115aa    MW: 13024 Da    PI: 8.8291
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr5g046870.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF97.94.3e-31959151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     krienk+nrqvtf+kRrng+lKKA+ELS LCdaeva+iifss+gklye++s
  Medtr5g046870.1  9 KRIENKINRQVTFAKRRNGMLKKAYELSLLCDAEVALIIFSSRGKLYEFCS 59
                     79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.786161IPR002100Transcription factor, MADS-box
CDDcd002651.44E-43278No hitNo description
SuperFamilySSF554559.68E-34282IPR002100Transcription factor, MADS-box
PRINTSPR004045.4E-33323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003196.9E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004045.4E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004045.4E-333859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0048440Biological Processcarpel development
GO:0048441Biological Processpetal development
GO:0048442Biological Processsepal development
GO:0048443Biological Processstamen development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 115 aa     Download sequence    Send to blast
MGRGKVELKR IENKINRQVT FAKRRNGMLK KAYELSLLCD AEVALIIFSS RGKLYEFCSG  60
TSMAKTIERY QRCSYGALEI NHQPEIETQV CEACVFRSQE STCSQSEGGR FVDR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1c7u_A1e-20270168MYOCYTE-SPECIFIC ENHANCER FACTOR 2A, C4 FORM
1c7u_B1e-20270168MYOCYTE-SPECIFIC ENHANCER FACTOR 2A, C4 FORM
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU4590401e-98CU459040.2 Medicago truncatula chromosome 5 clone mte1-1e23, COMPLETE SEQUENCE.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003614241.21e-79MADS-box transcription factor family protein
SwissprotP293828e-48SEP1_ARATH; Developmental protein SEPALLATA 1
TrEMBLG7JY401e-79G7JY40_MEDTR; MADS-box transcription factor family protein
STRINGGLYMA02G13401.15e-54(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15800.15e-49MIKC_MADS family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]