PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr5g046670.1
Common NameMTR_5g046670
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family SBP
Protein Properties Length: 501aa    MW: 56341.7 Da    PI: 7.5719
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr5g046670.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.61.3e-41243319177
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                      +Cqv gC++dls+ k+yh+rhkvC+vhsk+++v+v+g+eqrfCqqCsrfh + efD++krsCrrrLa+hnerrrk+q
  Medtr5g046670.1 243 VCQVYGCNMDLSSSKDYHKRHKVCDVHSKTAKVIVNGVEQRFCQQCSRFHLVAEFDDGKRSCRRRLAGHNERRRKPQ 319
                      6**************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.7E-33241305IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.59241318IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.28E-39242323IPR004333Transcription factor, SBP-box
PfamPF031101.8E-31244317IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 501 aa     Download sequence    Send to blast
MAALQQVKRK VEKGKVYRGG RSSGVVRTLG DAAAPADQYV APSQGTRFLH YFNISVTSIQ  60
FVVMESWSYI PEERSYLFSD EMDFSLDAFM RSRKPLVEWE NKSSCNFERD GFNSDREVVK  120
SMEFVDLGFP MESSRTVRGS VQTSSCELDS NNSSKRENSS VHVIAFDSSF AEEDSEAKHL  180
SSRVESKNHD SSLIDLKLGR LVDCRGGGSD RDGKTFTSES MPIHQNVLAK RSRTSSLPAL  240
APVCQVYGCN MDLSSSKDYH KRHKVCDVHS KTAKVIVNGV EQRFCQQCSR FHLVAEFDDG  300
KRSCRRRLAG HNERRRKPQF DYMTSKQHKI LQSYQGTNNF SFQDIFQSGI LFPEKHDQIS  360
QSGHIKLEED PICSPQLEAP ATHGHELSSH ALSLLSAQSQ NPLHQAAGNP SATSSTFFRD  420
IRTQDRGDQV SETPLMTSSM NKHERNESFP CGINSKENIK SEHGGTVDLF QLSSNLQRVE  480
KQRNSVLVKW ENEDCCFSNV *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A8e-292433171084squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr5g046670.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCR9329680.0CR932968.2 Medicago truncatula chromosome 5 clone mth2-8e17, COMPLETE SEQUENCE.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024640056.10.0squamosa promoter-binding-like protein 6 isoform X2
TrEMBLG7JX040.0G7JX04_MEDTR; Squamosa promoter-binding-like protein
STRINGAES971840.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.12e-59SBP family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]
  2. Aung B, et al.
    MicroRNA156 as a promising tool for alfalfa improvement.
    Plant Biotechnol. J., 2015. 13(6): p. 779-90
    [PMID:25532560]