PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr5g041530.1
Common NameMTR_5g041530
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family Dof
Protein Properties Length: 382aa    MW: 42430.1 Da    PI: 7.72
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr5g041530.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof112.61.8e-35137194360
           zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                      + +++cprC+s++tkfCyynny+++qPr+fCk+C+ryWt GGa rn+ vG+grrknk 
  Medtr5g041530.1 137 DVIVPCPRCKSMDTKFCYYNNYNVKQPRHFCKNCQRYWTSGGATRNMIVGAGRRKNKL 194
                      66789***************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-24135193IPR003851Zinc finger, Dof-type
PfamPF027015.7E-29140193IPR003851Zinc finger, Dof-type
PROSITE profilePS5088426.813140194IPR003851Zinc finger, Dof-type
PROSITE patternPS013610142178IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MTNDSTIKLF GRTIFQTHNT DVTTNDFSSE LEFGSPLPRD DSSDHSPYSS SCSPSEVNSP  60
TEHDAKRYKE TSRKELTSVQ EDEASFQTTE DSKSHTPSSH VENPKSPSSE TETSELNSHK  120
IDEQSDMSQE KSPMKQDVIV PCPRCKSMDT KFCYYNNYNV KQPRHFCKNC QRYWTSGGAT  180
RNMIVGAGRR KNKLNAANGL HSTTILTFGS DSPSMSSTSL DKKVNVASHE ETFDKSYQSF  240
PPQFPWNPAM CYPMSFCPDI AYYGGCLVPS WNVQSCGQNS TTLGKHSRDG NILLHSKSEK  300
EKLGSERCNK RVLIPKTLRI DDPNEIAKSS IWSTLGIKNG GELFMGFASK GGVKNHVQTS  360
SSVLQANPVA LSRSLVFHER I*
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr5g041530.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT0258400.0CT025840.2 Medicago truncatula chromosome 5 clone mth4-39c23, COMPLETE SEQUENCE.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003613833.10.0cyclic dof factor 3
TrEMBLG7KGM50.0G7KGM5_MEDTR; Cycling DOF factor 2
STRINGAES967910.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1731037
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62430.11e-59cycling DOF factor 1
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]