PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr5g041420.1
Common NameMTR_5g041420
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family Dof
Protein Properties Length: 323aa    MW: 35917.8 Da    PI: 7.0773
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr5g041420.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof113.97.1e-36134194262
           zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                      +++ ++cprC+st+tkfCyynny+++qPr+fCk+C+ryWt GG+ rn+ +G+grrknk ss
  Medtr5g041420.1 134 PDQVVPCPRCKSTDTKFCYYNNYNVKQPRHFCKNCQRYWTSGGTTRNMLIGAGRRKNKVSS 194
                      78999****************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-25132191IPR003851Zinc finger, Dof-type
PfamPF027014.3E-29135191IPR003851Zinc finger, Dof-type
PROSITE profilePS5088426.571138192IPR003851Zinc finger, Dof-type
PROSITE patternPS013610140176IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MINNSTITLF GRTIFITHNI DVSTNDSSSE SEFSPLPHED LSHHSLHSSM SSSSPLEVNS  60
STEHDAKRYK ETSRKELIED EASFQTTEDS ESPTSSSLIE NPKTPSSETE TSQANSTKID  120
EQTDMSQEKS PKKPDQVVPC PRCKSTDTKF CYYNNYNVKQ PRHFCKNCQR YWTSGGTTRN  180
MLIGAGRRKN KVSSSFNSDA SHYHQMSTVL TFGSDSPIMS SSSLDKKGNV GSLEKTFDKS  240
YQSFPQQIPW NPAMCYPVPI YPNIAFCGGC LIPSWSVQSI STQFDEPNKL TLGKHSRDGR  300
LSKGFASNPA ALSRSLLFHE MI*
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr5g041420.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT0258400.0CT025840.2 Medicago truncatula chromosome 5 clone mth4-39c23, COMPLETE SEQUENCE.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003613827.10.0cyclic dof factor 5
TrEMBLG7KGL90.0G7KGL9_MEDTR; DOF zinc finger protein
STRINGAES967850.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1731037
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62430.12e-37cycling DOF factor 1
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]