PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr5g031440.1
Common NameMTR_5g031440
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family Dof
Protein Properties Length: 337aa    MW: 36474 Da    PI: 9.4706
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr5g031440.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.48.8e-403999262
           zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                     +e+++kcprCds ntkfCyynnysl+qPr+fCk+CrryWtkGGalrnvP+Ggg+rknkk++
  Medtr5g031440.1 39 PEQNMKCPRCDSPNTKFCYYNNYSLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKNKKMK 99
                     6899******************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-254093IPR003851Zinc finger, Dof-type
PfamPF027015.9E-334197IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3014397IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104581IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010052Biological Processguard cell differentiation
GO:0010118Biological Processstomatal movement
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1902066Biological Processregulation of cell wall pectin metabolic process
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MSQNETQTSK SPKEKNNNQQ GSVGKKTSSS SSTSTTKPPE QNMKCPRCDS PNTKFCYYNN  60
YSLTQPRHFC KTCRRYWTKG GALRNVPIGG GCRKNKKMKS SSSRLSCDSK DSASSSSELV  120
GGLKFLHSLS SPSMDFHLGS GLSFPRLQLH NHPQISTTPM YNQFSSFGET SSAMNNNYHA  180
SSNSAAAMNY PFSSGNYNGA IQGMSSMNIN HSNNNIASSI ESLSSMNQDL HWKLQQQRLS  240
MLFGGGENQK DTEKPLQPIL FQNLEVAKQD DRAFSVGNSR TNGGDTATEW FFGNSYGSAA  300
ATPTASGGAG HDSGSNWNGG GVHGWNDVQQ QYSALP*
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr5g031440.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCR9369460.0CR936946.2 Medicago truncatula chromosome 5 clone mth2-77l22, COMPLETE SEQUENCE.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003612994.10.0dof zinc finger protein DOF5.7
TrEMBLG7KGJ70.0G7KGJ7_MEDTR; Dof domain zinc finger protein
STRINGAES959520.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38543460
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.12e-32Dof family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]