PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr5g026540.1
Common NameMTR_5g026540
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family Trihelix
Protein Properties Length: 303aa    MW: 35679 Da    PI: 8.4797
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr5g026540.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix88.66.9e-2845126186
         trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                      +W++qe+++ i++r e+e+++ ++k++k+lWe vs+kmrerg++rsp+qCk+kw+nl +ryk  ++++ ++     ++cp+f++l+
  Medtr5g026540.1  45 QWSQQETREFIAIRAELERDFTASKRNKTLWEVVSSKMRERGYRRSPEQCKCKWKNLVNRYKGKETSDPEH----GKQCPFFEELH 126
                      7****************************************************************999986....678******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.5E-442104IPR001005SANT/Myb domain
PfamPF138373.0E-2444127No hitNo description
CDDcd122031.40E-2644109No hitNo description
PROSITE profilePS500907.746102IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MYGGGGGDDA LAARLGIVPQ SLLIPTSSLM SPAAMREERV PAQPQWSQQE TREFIAIRAE  60
LERDFTASKR NKTLWEVVSS KMRERGYRRS PEQCKCKWKN LVNRYKGKET SDPEHGKQCP  120
FFEELHAVFT ERAHSMQRLL LESETRSAQT KKGVKKIRSG DRSSDEFSED DEEVEDDSEE  180
ERPVRSNTRK RKAGKIATEK SSRANNANNS TGNIQEMLKE FFQHQLKVEM QWREVMERRA  240
HEKQLFEQEW RQSMEKLERE RLMIEQEWRE REEHRRLREE NRAERRDALL TTLLNKLIHE  300
SN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ebi_A1e-1446116777DNA binding protein GT-1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU9141350.0CU914135.3 Medicago truncatula chromosome 5 clone mth4-3n15, COMPLETE SEQUENCE.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003612572.10.0trihelix transcription factor GT-3a-like protein
TrEMBLG7K6R00.0G7K6R0_MEDTR; Trihelix transcription factor GT-3a-like protein
STRINGGLYMA01G35370.21e-165(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.14e-39Trihelix family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]