PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr5g021340.1
Common NameMTR_5g021340
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family GATA
Protein Properties Length: 391aa    MW: 43240.4 Da    PI: 7.4212
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr5g021340.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA627.4e-20302336135
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                      Cs+Cg+tkTp+WR+gp g ktLCnaCG+++++ +l
  Medtr5g021340.1 302 CSHCGVTKTPQWRSGPLGAKTLCNACGVRFKSGRL 336
                      *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.11296332IPR000679Zinc finger, GATA-type
SMARTSM004017.8E-18296350IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.9E-14298358No hitNo description
Gene3DG3DSA:3.30.50.104.8E-15300334IPR013088Zinc finger, NHR/GATA-type
CDDcd002025.11E-16301349No hitNo description
PfamPF003201.2E-17302336IPR000679Zinc finger, GATA-type
PROSITE patternPS003440302327IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MLYQTSYPLL FQFHPLHSSS TTIPLSTISP QKLSLFSHLP HPHSQVSKTV MECVVETALK  60
TSLRKDITPQ TFVDEISALN AQNGTTSDDF FVDDLLDFSH VEEQQQQQEQ EEQHQQQQEH  120
SLCLSLKQNH ETSNPNTTFS LKEDYSSLPT NDLNVPSDDV ADLEWLSHFV EDSDSFSGMA  180
LTTTTEKNPK SFVVFEEPKP KQENSVFTTF KTPVQTKARS KRARTGVRVW PFGSTDSSSS  240
STTTTTSSST SSSPTSPLMI YTNMLQVQSF DSVKVKKPKK IASSNGSGHV GAVVMAAPPR  300
RCSHCGVTKT PQWRSGPLGA KTLCNACGVR FKSGRLLPEY RPACSPTFSS ELHSNHHRKV  360
LEMRRKKEVV GGVEIEVETG LSRSPVVPSF *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.240140.0leaf| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1364510.0AC136451.9 Medicago truncatula clone mth2-17d19, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003612107.10.0GATA type zinc finger transcription factor family protein
TrEMBLG7KGC30.0G7KGC3_MEDTR; GATA type zinc finger transcription factor family protein
STRINGGLYMA01G37450.11e-113(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.23e-65GATA transcription factor 5
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]