PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr5g014040.4
Common NameMTR_5g014040
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family G2-like
Protein Properties Length: 509aa    MW: 56875.5 Da    PI: 6.9944
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr5g014040.4genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like77.81.4e-24271322153
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkY 53 
                      k +++Wt eLH++Fv+aveqL G+++A+P++ilelmkv+gLt+++v+SHLQ +
  Medtr5g014040.4 271 KMKVDWTAELHKKFVKAVEQL-GIDQAIPSRILELMKVDGLTRHNVASHLQIF 322
                      5689*****************.****************************743 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011014.408192IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.35E-5691No hitNo description
Gene3DG3DSA:3.40.50.23005.6E-106106No hitNo description
SuperFamilySSF521721.22E-8695IPR011006CheY-like superfamily
PfamPF000727.0E-5686IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5129414.443268327IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-23269333IPR009057Homeodomain-like
SuperFamilySSF466891.61E-15270323IPR009057Homeodomain-like
TIGRFAMsTIGR015573.5E-22271323IPR006447Myb domain, plants
PfamPF002497.2E-6274320IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 509 aa     Download sequence    Send to blast
MASFSTFYNE NEALSAISSS PKCFHVAIVE VSISCPDGGF KFLENAKDLP TIMTSNSQCI  60
NTMMKCIALG AVEFLTKPLS EDKLKNIWQH VVHKAFNAEA SALSESLKPV KESVESMLHL  120
QTDNTLHEST ISIDLDKVSK FSDNEHEHSA ASDKYPAPST PQLKQGARLV DDGDCHEQTN  180
CLIEKESGEH DSGECKFVDT SCENLNAESS PQPTKHLIKE EEDFAKGSKG EGGASLNPLN  240
KNFLGDAGGN TSLNKTRVFN DPCENKANRK KMKVDWTAEL HKKFVKAVEQ LGIDQAIPSR  300
ILELMKVDGL TRHNVASHLQ IFVEQKYRMH KRQIIHTDED RKWPNRRDPM QRNYCMQRPI  360
MAYPPYHSNH TFPPAPAYPM WGQHGSQTAG VPIWSPPGYP LWQPTESWHW KPYPPGVHVD  420
AWGNPMLRPP QTHCIPYTQN MAGMHNAKAV DYSYPAEEVV DKAVKEAINK PWLPLPIGLK  480
PPSMDSVLDE LSKQGIPFSK KSKGSRPC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A6e-15269322356ARR10-B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.140790.0flower| glandular trichome| leaf| pod| root| stem
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr5g014040.4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1445160.0AC144516.5 Medicago truncatula clone mth2-28p22, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024640324.10.0two-component response regulator-like APRR2 isoform X3
SwissprotQ6LA431e-114APRR2_ARATH; Two-component response regulator-like APRR2
TrEMBLA0A072UDH50.0A0A072UDH5_MEDTR; Two-component response regulator-APRR2-like protein
STRINGAES943980.0(Medicago truncatula)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18020.61e-117ARR-B family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]
  2. Gong L, et al.
    Transcriptome Profiling of the Potato (Solanum tuberosum L.) Plant under Drought Stress and Water-Stimulus Conditions.
    PLoS ONE, 2015. 10(5): p. e0128041
    [PMID:26010543]