PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr5g011070.1
Common NameMTR_5g011070
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family TALE
Protein Properties Length: 306aa    MW: 34508.9 Da    PI: 6.6498
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr5g011070.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.11.2e-072412742154
                      HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      k +yp+++++++L +++gL+ +q+ +WF N+R +
  Medtr5g011070.1 241 KWPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 274
                      469*****************************87 PP

2ELK25.43.2e-09195216122
              ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                      ELK +L++++++++ ++++E++
  Medtr5g011070.1 195 ELKIELKQGFKSRIEDVREEIL 216
                      9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.4E-192569IPR005540KNOX1
PfamPF037901.1E-172768IPR005540KNOX1
SMARTSM012569.7E-2380135IPR005541KNOX2
PfamPF037913.4E-1683134IPR005541KNOX2
PROSITE profilePS512139.132195215IPR005539ELK domain
PROSITE profilePS5007111.71215278IPR001356Homeobox domain
SuperFamilySSF466897.27E-16217282IPR009057Homeodomain-like
SMARTSM003895.3E-11217282IPR001356Homeobox domain
CDDcd000867.74E-11218279No hitNo description
Gene3DG3DSA:1.10.10.604.2E-25222280IPR009057Homeodomain-like
PfamPF059201.1E-17235274IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010089Biological Processxylem development
GO:0010192Biological Processmucilage biosynthetic process
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top