PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr4g471590.1
Common NameMTR_4g071590, MTR_4g471590
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family GATA
Protein Properties Length: 297aa    MW: 33117.8 Da    PI: 5.443
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr4g471590.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA60.71.8e-19213246134
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                      Cs+C++ kTp+WR gp g+ktLCnaCG+++++ +
  Medtr4g471590.1 213 CSHCHVQKTPQWRAGPLGPKTLCNACGVRFKSGR 246
                      *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169923.9E-7424295IPR016679Transcription factor, GATA, plant
SMARTSM004019.5E-16207261IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.33E-14209270No hitNo description
PROSITE profilePS5011411.134211243IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.6E-14211244IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.33E-14212269No hitNo description
PfamPF003203.2E-17213246IPR000679Zinc finger, GATA-type
PROSITE patternPS003440213238IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MEVVVAEALK PSLRTESIFQ QTICEEILCL NANNVVVGED FSVDDLLDFS NGEFQHGSVG  60
KEVDVCEEEE EEEHEKNSTT SGSEHERTED DDNSNSTTFS GAGDGESNSI FAGGLAVPAD  120
DVADLEWVSH FVDDSIPELS LLYPVQARSE PEPRPGPTNA YSQLSIIRRK PRTTKTRRPN  180
CNVWIFNPIL YSAKKQRKKP EAQTGGAHFQ RRCSHCHVQK TPQWRAGPLG PKTLCNACGV  240
RFKSGRLFPE YRPACSPTFS GEIHSNSHRK VLEMRRRKEV DEPVSGLNRI QMVTSW*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.179910.0leaf| root
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1466890.0BT146689.1 Medicago truncatula clone JCVI-FLMt-4K11 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003607047.10.0GATA type zinc finger transcription factor family protein
RefseqXP_013456438.10.0GATA type zinc finger transcription factor family protein
TrEMBLG7JJU10.0G7JJU1_MEDTR; GATA type zinc finger transcription factor family protein
STRINGGLYMA12G04180.21e-125(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36240.14e-50GATA transcription factor 7
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]