PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr4g461080.1
Common NameMTR_4g461080
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family Dof
Protein Properties Length: 278aa    MW: 30935.4 Da    PI: 7.9127
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr4g461080.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof127.44.1e-402686363
           zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63
                      +alkcprCds+ntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rknk+sss
  Medtr4g461080.1 26 PEALKCPRCDSNNTKFCYYNNYSLSQPRYFCKSCRRYWTKGGTLRNVPVGGGCRKNKRSSS 86
                     6789*****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-281378IPR003851Zinc finger, Dof-type
PfamPF027018.7E-342883IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.592983IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103167IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MSNQSLESML TCSKGEQDKK PKPPQPEALK CPRCDSNNTK FCYYNNYSLS QPRYFCKSCR  60
RYWTKGGTLR NVPVGGGCRK NKRSSSASSK RSQDQPFQTN PNPLTCFPSL SYDSNDLTLA  120
LARLQKGHLG FDHEHDFSIL GNQTNTSCGI LNNHGMNHSS NNQGFFEALM GSQNNVQNLY  180
YMGEVDNGNA NGNGNGEMML PYDHEMSIAT TQAVTVTTMK QEMCNVREQN ENRVLLGFPW  240
QFNNGDTNMA EMDHLGRAGW NGLTSSWGHG LLNSPLM*
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr4g461080.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1376680.0AC137668.18 Medicago truncatula clone mth2-5f8, complete sequence.
GenBankAC1492680.0AC149268.21 Medicago truncatula clone mth2-94j16, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013456040.20.0dof zinc finger protein DOF2.1
TrEMBLA0A396I5B70.0A0A396I5B7_MEDTR; Putative transcription factor C2C2-Dof family
STRINGXP_004505949.11e-151(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50263051
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28510.19e-50Dof family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]