PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr4g133938.1
Common NameMTR_4g133938, NF-YB8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family NF-YB
Protein Properties Length: 137aa    MW: 15333.4 Da    PI: 5.0823
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr4g133938.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB170.51.9e-5320113497
            NF-YB   4 qdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                      q+r+lPianv+rimkk+lP++akisk+aket+qecvsefisf+t+eas+kcq+ekrktingddl+wa++tlGfe+y+eplk yl kyre+eg+k
  Medtr4g133938.1  20 QERLLPIANVGRIMKKALPTRAKISKEAKETMQECVSEFISFITGEASEKCQKEKRKTINGDDLVWAMTTLGFEEYAEPLKGYLLKYREIEGDK 113
                      89******************************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.4E-5019122IPR009072Histone-fold
SuperFamilySSF471131.34E-3820115IPR009072Histone-fold
PfamPF008086.8E-282387IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006159.7E-205169No hitNo description
PROSITE patternPS0068505470IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006159.7E-207088No hitNo description
PRINTSPR006159.7E-2089107No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 137 aa     Download sequence    Send to blast
MAESDDESGG QASGSRELLQ ERLLPIANVG RIMKKALPTR AKISKEAKET MQECVSEFIS  60
FITGEASEKC QKEKRKTING DDLVWAMTTL GFEEYAEPLK GYLLKYREIE GDKNFSMNMI  120
GSNKEQEGSI HRFFQG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B4e-4520108492Transcription factor HapC (Eurofung)
4g92_B4e-4520108492Transcription factor HapC (Eurofung)
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.263140.0root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:11250072}.
Functional Description ? help Back to Top
Source Description
UniProtComponent of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr4g133938.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ9182810.0JQ918281.1 Medicago truncatula nuclear trancsription factor Y subunit B8 (NF-YB8) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013458655.16e-97nuclear transcription factor Y subunit B-3
SwissprotO233103e-58NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLI3TAW61e-95I3TAW6_MEDTR; Nuclear trancsription factor Y subunit B8
STRINGXP_004507593.14e-75(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.11e-60nuclear factor Y, subunit B3
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]
  2. Han X, et al.
    Overexpression of the poplar NF-YB7 transcription factor confers drought tolerance and improves water-use efficiency in Arabidopsis.
    J. Exp. Bot., 2013. 64(14): p. 4589-601
    [PMID:24006421]
  3. Hwang YH, et al.
    Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time.
    Plant Cell Rep., 2016. 35(4): p. 857-65
    [PMID:26754793]
  4. Hossain MA, et al.
    Identification of Novel Components of the Unfolded Protein Response in Arabidopsis.
    Front Plant Sci, 2016. 7: p. 650
    [PMID:27242851]
  5. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]