PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr4g131600.1
Common NameMTR_4g131600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family ARR-B
Protein Properties Length: 591aa    MW: 65555.3 Da    PI: 4.6536
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr4g131600.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like82.45.1e-26201254155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      kprl+W +eLH++Fv+av++  G +kA Pk+il+lm+v+gLt+e+v SHLQ+YR+
  Medtr4g131600.1 201 KPRLVWDHELHRKFVSAVNHV-GLDKASPKKILDLMNVEGLTRENVSSHLQRYRI 254
                      79*******************.********************************7 PP

2Response_reg70.19.3e-24261341109
                      EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHT CS
     Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealka 92 
                      vl vdD+p+ +++l++ l   +y +v++++++ ealell+ek+  +Dl++ D++mp+mdG++ll++   e  +lp i+++ +++ e + + +  
  Medtr4g131600.1  26 VLAVDDDPTYLKVLEKQLLTCNY-NVTTTTKPVEALELLREKKdmFDLVISDVSMPDMDGFKLLEQVGLEM-DLPFIMLSVNDDIEKVMKSVIH 117
                      799********************.***************999999**********************6644.8********************* PP

                      TESEEEESS--HHHHHH CS
     Response_reg  93 GakdflsKpfdpeelvk 109
                      Ga  +l+Kp+ +eel  
  Medtr4g131600.1 118 GACNYLVKPIRMEELKS 134
                      **************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363922.0E-1326583IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23001.6E-3823147No hitNo description
SuperFamilySSF521726.97E-3323147IPR011006CheY-like superfamily
SMARTSM004482.9E-2724136IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011039.89925140IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.6E-2126134IPR001789Signal transduction response regulator, receiver domain
CDDcd001566.71E-2627139No hitNo description
SuperFamilySSF466897.88E-17198257IPR009057Homeodomain-like
PROSITE profilePS5129410.261198257IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.7E-27199256IPR009057Homeodomain-like
TIGRFAMsTIGR015574.3E-22201254IPR006447Myb domain, plants
PfamPF002499.8E-6204253IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 591 aa     Download sequence    Send to blast
MMVVVVEDSF GVVNVLGEGF PAGMRVLAVD DDPTYLKVLE KQLLTCNYNV TTTTKPVEAL  60
ELLREKKDMF DLVISDVSMP DMDGFKLLEQ VGLEMDLPFI MLSVNDDIEK VMKSVIHGAC  120
NYLVKPIRME ELKSIWQHVV RKKIESKDQN QGIISDGVYG QDTSSENIAN KNKMHGRKRK  180
EQTEEEEAEQ DNDEKCSTRK KPRLVWDHEL HRKFVSAVNH VGLDKASPKK ILDLMNVEGL  240
TRENVSSHLQ RYRIDIKWLS KQDRGDDALD PYQQKGSVGG YGDFCTLSGS TRVLSSILPA  300
YASNDMFCRL NAPSSLNLEG MSSSALVPPL QSHNIPNFET PMFSESESSS SVHGIQTSMD  360
INQFQQNIYL PDNINLSPID DSNAVTDSSS FQDIGATVNN ANVSLSCISS NHIQTHKSGA  420
FINHSHVEGA AVKTQSFNPV TSGSSNFASN SVPLSEDFNN DQMLHNNFKF ASPSSHFSST  480
DIVAVPLEET MQCQDGLLGN VINAPWYTQH QNASSSFNNT LDYLASSNGD TSSMVHGLAQ  540
TNSSLITQMP EVEKFYSDER TMESNGDCFY EQLLSLDGFI QNSCVPWMTQ *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A8e-23197260164ARR10-B
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr4g131600.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1700840.0AC170084.14 Medicago truncatula clone mth2-156k10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024636615.10.0two-component response regulator ORR24
TrEMBLG7JHZ30.0G7JHZ3_MEDTR; Two-component response regulator
STRINGAES925800.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.16e-87response regulator 12
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]