PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr4g131580.1
Common NameMTR_4g131580
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family ARR-B
Protein Properties Length: 608aa    MW: 67433.5 Da    PI: 5.2309
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr4g131580.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like81.31.1e-25200253155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      kpr +W +eLH++Fv+ v+ L G +kA Pk+i++lm+v+gLt+e+v+SHLQkYRl
  Medtr4g131580.1 200 KPRFVWDNELHKKFVSIVNLL-GLDKAYPKKIRDLMNVEGLTRENVASHLQKYRL 253
                      79*******************.********************************8 PP

2Response_reg75.42.1e-25231311109
                      EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHT CS
     Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealka 92 
                      vl vdD+++ +++l++ l   +y +v++++++ ealell+ek+  +Dli+ D++mp+mdG++ll++   e  +lp i++++h++ e + + +  
  Medtr4g131580.1  23 VLAVDDDQTSLKVLEKHLLTCKY-NVTTTTKSVEALELLREKRsmFDLIISDVNMPEMDGFKLLEQVGLEM-DLPFIMLSGHDDRERVMKGVMK 114
                      799********************.*****************999***********************6644.8********************* PP

                      TESEEEESS--HHHHHH CS
     Response_reg  93 GakdflsKpfdpeelvk 109
                      Ga d+l+Kp+  eel +
  Medtr4g131580.1 115 GACDYLVKPIRLEELKN 131
                      **************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363925.6E-1341588IPR017053Response regulator B-type, plant
SuperFamilySSF521726.55E-3420143IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23008.0E-4120144No hitNo description
SMARTSM004483.4E-3021133IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011041.60122137IPR001789Signal transduction response regulator, receiver domain
PfamPF000729.8E-2323131IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.56E-2824136No hitNo description
SuperFamilySSF466892.51E-18197257IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-26198257IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-22200253IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 608 aa     Download sequence    Send to blast
MAVEDRLVGE DVTEEGFPVG MRVLAVDDDQ TSLKVLEKHL LTCKYNVTTT TKSVEALELL  60
REKRSMFDLI ISDVNMPEMD GFKLLEQVGL EMDLPFIMLS GHDDRERVMK GVMKGACDYL  120
VKPIRLEELK NIWQHVVRKK IESKDQNQGI ISDGVSGQDT SSENIPKKNK THGRKRKEQS  180
EEEEADTDEE NDEEHSTRKK PRFVWDNELH KKFVSIVNLL GLDKAYPKKI RDLMNVEGLT  240
RENVASHLQK YRLSLKRPSK QAKVDAALDP LQQKGSVRGY GDFCTLPGSR RILSSTLPTY  300
ASSGMFCRLN APSSLNFRRM SPSAPVPPLQ SQNILSFKQP MFSASESLSF SQGVRTSAEI  360
NQFQRNIYPL GNKNLNPIDY TSAFTVSSGF QDIRDTVNNA NSSLSCISSN NLSTHNSGAF  420
VNHSSVGGAY VEPKSFNPAT YGSSNFASNP SPLSEDFNND QISGNSLNFA SPSSHFRKSP  480
VDFSSTLAVP SEEAMQCQDG LLGNVVKASC YTTQQQNVSS SFNNTLDSLA SYNEDTSSMV  540
QSVPQTNSQL MTQMPQVEKF YSDARVTEPR GDCFFEQLLA LDGLIENSCV SLDDTISEAV  600
KQQSPSD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-20196259164ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr4g131580.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1700840.0AC170084.14 Medicago truncatula clone mth2-156k10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003610382.30.0two-component response regulator ARR10
SwissprotA2X1N22e-96ORR24_ORYSI; Two-component response regulator ORR24
TrEMBLG7JHZ20.0G7JHZ2_MEDTR; Two-component response regulator
STRINGAES925790.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.12e-92response regulator 12
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]