PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr4g131570.1
Common NameMTR_4g131570
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family ARR-B
Protein Properties Length: 597aa    MW: 66723 Da    PI: 4.8644
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr4g131570.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like79.44.2e-25203256155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      kprl+W  eLH++Fv+ v+qL G +kA Pk+i +lm+v+gLt+e+v+SHLQkY+l
  Medtr4g131570.1 203 KPRLVWDDELHKKFVSIVSQL-GLDKAYPKKICDLMNVEGLTRENVASHLQKYKL 256
                      79*******************.*******************************97 PP

2Response_reg73.49.2e-25231311109
                      EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHT CS
     Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealka 92 
                      vl vdD+++ ++ll+++l   +y +v++++++ ealell+ek+  +Dl++ D++mp+mdG++ll++   e  +lp i+++++++ e + + +  
  Medtr4g131570.1  23 VLAVDDDQTCLKLLEKFLLMCKY-NVTTTTKPVEALELLREKRdmFDLVISDVSMPEMDGFKLLEQVGLEI-DLPFIMLSGNDDRERVMKGVMK 114
                      799********************.***************99999***********************6655.7********************* PP

                      TESEEEESS--HHHHHH CS
     Response_reg  93 GakdflsKpfdpeelvk 109
                      Ga d+l+Kp+  eel +
  Medtr4g131570.1 115 GACDYLVKPIRLEELKN 131
                      **************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363928.6E-1352587IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23004.5E-4020144No hitNo description
SuperFamilySSF521722.42E-3320142IPR011006CheY-like superfamily
SMARTSM004486.2E-2921133IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011040.39622137IPR001789Signal transduction response regulator, receiver domain
PfamPF000722.8E-2223131IPR001789Signal transduction response regulator, receiver domain
CDDcd001565.99E-2724136No hitNo description
Gene3DG3DSA:3.40.50.23004.5E-40184188No hitNo description
SuperFamilySSF466891.79E-17200260IPR009057Homeodomain-like
PROSITE profilePS512949.934200259IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-26201260IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-21203256IPR006447Myb domain, plants
PfamPF002493.0E-6206255IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 597 aa     Download sequence    Send to blast
MAVENPLEVE NVFREDFPVG MRVLAVDDDQ TCLKLLEKFL LMCKYNVTTT TKPVEALELL  60
REKRDMFDLV ISDVSMPEMD GFKLLEQVGL EIDLPFIMLS GNDDRERVMK GVMKGACDYL  120
VKPIRLEELK NIWQHVVRKK IESKDRNKGI ITDGICSQDT SSENIANRNK TRGQKIKEQS  180
EDEEEEEEEA EEDNDEERST RKKPRLVWDD ELHKKFVSIV SQLGLDKAYP KKICDLMNVE  240
GLTRENVASH LQKYKLSLKR PSKQARVDAA LDPHLQKNSV AGYGDFCTLP GSRRILSSTL  300
PTYASSNMFC RLNAPSGLNL RGMSSSALVP PLQSQNIPSY KQPLFFASES SSALKGVRTS  360
VEINQFQQNI YPPGNMKLSP IDDSSAFTDS SGFQDIRANV NNANSFLSCI SSNHLQTHNS  420
RAFINHPSVG GPAMEQKSFN PATSGSYNFA SNPSPLSEDF NNDQISHNSL KFASLSSQFK  480
KNPDDFSSIR VIDVPLEETM QCQDGLLGSV VTASCYTHQQ NVGSSFNNTL DSSNADTSSM  540
VHSVPQTISP LITQMPVVEK FYSDERTMES NGDCFFEQLL DVDGFVQNSS LPWMTQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A1e-20203259157Transcription factor LUX
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr4g131570.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1700840.0AC170084.14 Medicago truncatula clone mth2-156k10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024636936.10.0two-component response regulator ARR12
TrEMBLG7JHZ10.0G7JHZ1_MEDTR; Two-component response regulator
STRINGAES925780.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.12e-96response regulator 12
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]