PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr4g127140.1
Common NameMTR_4g127140
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family M-type_MADS
Protein Properties Length: 187aa    MW: 21924.1 Da    PI: 7.1901
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr4g127140.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF688.9e-221967149
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                     k++e +s++qvtfskRr+g++ KA+EL+vLCd+ +a+i+fs+ +kl+ +
  Medtr4g127140.1 19 KKVEKESQKQVTFSKRRQGLFRKASELCVLCDVHAAIIVFSPGDKLFCF 67
                     578999***************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.2E-311170IPR002100Transcription factor, MADS-box
PROSITE profilePS5006625.5391171IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-261181IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-191333IPR002100Transcription factor, MADS-box
PfamPF003191.9E-222067IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-193348IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-194869IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MDMVNQRKKN MGRKKIEIKK VEKESQKQVT FSKRRQGLFR KASELCVLCD VHAAIIVFSP  60
GDKLFCFGQP DTYSVLNSYI KGTTEFEDSK VAENFLTYQD YNRQYVEAQK MLEMEKKKLE  120
DVQNLAKIFN KGGDWWNDSI DDMRWNDSID DMSSDQLEQF MISIYELRRK LVERADELVM  180
KQSAMP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P8e-151179169Myocyte-specific enhancer factor 2B
1tqe_Q8e-151179169Myocyte-specific enhancer factor 2B
1tqe_R8e-151179169Myocyte-specific enhancer factor 2B
1tqe_S8e-151179169Myocyte-specific enhancer factor 2B
3kov_A6e-151279168Myocyte-specific enhancer factor 2A
3kov_B6e-151279168Myocyte-specific enhancer factor 2A
3kov_I6e-151279168Myocyte-specific enhancer factor 2A
3kov_J6e-151279168Myocyte-specific enhancer factor 2A
3mu6_A6e-151279168Myocyte-specific enhancer factor 2A
3mu6_B6e-151279168Myocyte-specific enhancer factor 2A
3mu6_C6e-151279168Myocyte-specific enhancer factor 2A
3mu6_D6e-151279168Myocyte-specific enhancer factor 2A
3p57_A6e-151279168Myocyte-specific enhancer factor 2A
3p57_B6e-151279168Myocyte-specific enhancer factor 2A
3p57_C6e-151279168Myocyte-specific enhancer factor 2A
3p57_D6e-151279168Myocyte-specific enhancer factor 2A
3p57_I6e-151279168Myocyte-specific enhancer factor 2A
3p57_J6e-151279168Myocyte-specific enhancer factor 2A
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1743570.0AC174357.6 Medicago truncatula chromosome 8 clone mth2-26c10, complete sequence.
GenBankBT1425420.0BT142542.1 Medicago truncatula clone JCVI-FLMt-2F17 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003610029.21e-137MADS-box transcription factor family protein
TrEMBLG7JTA21e-137G7JTA2_MEDTR; MADS-box transcription factor family protein
STRINGGLYMA20G27361.13e-61(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.17e-20AGAMOUS-like 62
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]