PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr4g121020.2
Common NameMTR_4g121020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family G2-like
Protein Properties Length: 578aa    MW: 62931.1 Da    PI: 6.4668
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr4g121020.2genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like92.24.2e-29111164155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      kpr++W+ eLH++Fv+av+qL G++kA+Pk+ilelm+v+gLt+e+v+SHLQkYRl
  Medtr4g121020.2 111 KPRVVWSVELHQQFVDAVDQL-GIDKAVPKKILELMNVPGLTRENVASHLQKYRL 164
                      79*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011015.569147IPR001789Signal transduction response regulator, receiver domain
Gene3DG3DSA:3.40.50.23007.9E-12565No hitNo description
SuperFamilySSF521723.42E-8552IPR011006CheY-like superfamily
SuperFamilySSF466893.4E-20108168IPR009057Homeodomain-like
PROSITE profilePS5129411.502108167IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-30110169IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-25111164IPR006447Myb domain, plants
PfamPF002497.7E-8113163IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009873Biological Processethylene-activated signaling pathway
GO:0010082Biological Processregulation of root meristem growth
GO:0010119Biological Processregulation of stomatal movement
GO:0010150Biological Processleaf senescence
GO:0071368Biological Processcellular response to cytokinin stimulus
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 578 aa     Download sequence    Send to blast
MFCMMIIVMS ADDGKSVVMK GVTHGACDYL IKPVRIEALK NIWQHVVRKK KNEWKDTEQS  60
GSADEGDRHP KASDDADYSS SANEGNWRNS RKRRDDEEEG DDRDDSSTLK KPRVVWSVEL  120
HQQFVDAVDQ LGIDKAVPKK ILELMNVPGL TRENVASHLQ KYRLYLRRLS GVSQHQNNSF  180
LSPQEASFGT ISSMNGLDLQ TLAAAGQLPA QSLATLQAAG LGRSTVKSGL PMPLMDQRNL  240
FSFENPRLRF GEGQQQLLNG SNNKPTNLLH GVPTNMEPKQ LANLHQSAAQ SLGNMNMRVP  300
ASATQGNPLL MQMAQSQPRG PMLSENTGSH VPRLPNLLGQ STVSNGISDG LMGRNNMASS  360
SRAPSFNPVP QSSSFLNFPM NQSTEMSVSN FPLGSTPGIS SITTKGSFQA EVNSGIKGSA  420
GFPSYDIFNE LNHQKSRDWG MTNQGLMYDS SSHANPLHGN IDVSPSVLVH QGFSSAQQTG  480
HSRDASLLGK SPFSLGEGLE QGNLQNGGGQ HFNPLYVENL TRVKAERVPD ASSHTDLFPD  540
HFGQDDLMSA LLKQQEGIGQ GENEFDFDGY SLDNIPV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-22110170464ARR10-B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.90460.0flower| glandular trichome| leaf| root| stem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Detected in the whole plant. Predominantly expressed in pollen. {ECO:0000269|PubMed:11370868, ECO:0000269|PubMed:15173562, ECO:0000269|PubMed:9891419}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins. Involved in the expression of nuclear genes for components of mitochondrial complex I. Promotes cytokinin-mediated leaf longevity. Involved in the ethylene signaling pathway in an ETR1-dependent manner and in the cytokinin signaling pathway. {ECO:0000269|PubMed:11370868, ECO:0000269|PubMed:11574878, ECO:0000269|PubMed:15282545, ECO:0000269|PubMed:16407152}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00054PBMTransfer from AT4G16110Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr4g121020.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013458294.10.0two-component response regulator ARR2 isoform X1
SwissprotQ9ZWJ91e-152ARR2_ARATH; Two-component response regulator ARR2
TrEMBLA0A072USL70.0A0A072USL7_MEDTR; Two-component response regulator ARR2-like protein
STRINGGLYMA17G03380.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.11e-141response regulator 2
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]
  2. Takahashi N, et al.
    Cytokinins control endocycle onset by promoting the expression of an APC/C activator in Arabidopsis roots.
    Curr. Biol., 2013. 23(18): p. 1812-7
    [PMID:24035544]
  3. Ge XM, et al.
    Heterotrimeric G protein mediates ethylene-induced stomatal closure via hydrogen peroxide synthesis in Arabidopsis.
    Plant J., 2015. 82(1): p. 138-50
    [PMID:25704455]
  4. Takahashi N,Umeda M
    Cytokinins promote onset of endoreplication by controlling cell cycle machinery.
    Plant Signal Behav, 2014. 9(8): p. e29396
    [PMID:25763620]
  5. Kobayashi K, et al.
    Shoot Removal Induces Chloroplast Development in Roots via Cytokinin Signaling.
    Plant Physiol., 2017. 173(4): p. 2340-2355
    [PMID:28193764]
  6. Arnaud D, et al.
    Cytokinin-Mediated Regulation of Reactive Oxygen Species Homeostasis Modulates Stomatal Immunity in Arabidopsis.
    Plant Cell, 2017. 29(3): p. 543-559
    [PMID:28254779]
  7. Zhang TQ, et al.
    A Two-Step Model for de Novo Activation of WUSCHEL during Plant Shoot Regeneration.
    Plant Cell, 2017. 29(5): p. 1073-1087
    [PMID:28389585]
  8. Meng WJ, et al.
    Type-B ARABIDOPSIS RESPONSE REGULATORs Specify the Shoot Stem Cell Niche by Dual Regulation of WUSCHEL.
    Plant Cell, 2017. 29(6): p. 1357-1372
    [PMID:28576846]
  9. Zhang F,May A,Irish VF
    Type-B ARABIDOPSIS RESPONSE REGULATORs Directly Activate WUSCHEL.
    Trends Plant Sci., 2017. 22(10): p. 815-817
    [PMID:28886911]
  10. Takatsuka H,Higaki T,Umeda M
    Actin Reorganization Triggers Rapid Cell Elongation in Roots.
    Plant Physiol., 2018. 178(3): p. 1130-1141
    [PMID:30185441]