PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr4g119500.1
Common NameMTR_4g119500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family NF-YB
Protein Properties Length: 130aa    MW: 14750.5 Da    PI: 5.3058
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr4g119500.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB174.11.5e-5421116297
            NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                      +eqdr+lPianv+rimk++lP+nakisk++ket+qecvsefisfvtseas+kc++e+rkt+ngdd++wal+tlGf+dy+ep++ yl++yrele 
  Medtr4g119500.1  21 KEQDRLLPIANVGRIMKQILPQNAKISKESKETMQECVSEFISFVTSEASEKCRKERRKTVNGDDICWALGTLGFDDYAEPMRRYLHRYRELEV 114
                      89*******************************************************************************************9 PP

            NF-YB  96 ek 97 
                      ++
  Medtr4g119500.1 115 DR 116
                      87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.6E-5018118IPR009072Histone-fold
SuperFamilySSF471133.73E-3823118IPR009072Histone-fold
PfamPF008082.4E-272690IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.9E-185472No hitNo description
PROSITE patternPS0068505773IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.9E-187391No hitNo description
PRINTSPR006151.9E-1892110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 130 aa     Download sequence    Send to blast
MMDNNVGGSS FSNDENGGII KEQDRLLPIA NVGRIMKQIL PQNAKISKES KETMQECVSE  60
FISFVTSEAS EKCRKERRKT VNGDDICWAL GTLGFDDYAE PMRRYLHRYR ELEVDRTPTT  120
TNNIQDRGN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B3e-4520111192Transcription factor HapC (Eurofung)
4g92_B3e-4520111192Transcription factor HapC (Eurofung)
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in flowers and siliques. {ECO:0000269|PubMed:11250072}.
Functional Description ? help Back to Top
Source Description
UniProtComponent of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr4g119500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1743710.0AC174371.23 Medicago truncatula chromosome 8 clone mth2-50f21, complete sequence.
GenBankBT1370510.0BT137051.1 Medicago truncatula clone JCVI-FLMt-1H17 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024637540.18e-80nuclear transcription factor Y subunit B-10
SwissprotO822486e-55NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLG7JKC36e-92G7JKC3_MEDTR; Nuclear transcription factor Y protein
STRINGAES918432e-78(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.13e-57nuclear factor Y, subunit B5
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]
  2. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]