PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr4g114730.1
Common NameMTR_4g114730
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family YABBY
Protein Properties Length: 192aa    MW: 21536.6 Da    PI: 8.3382
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr4g114730.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY203.67.8e-63121646170
            YABBY   6 sseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvsse 99 
                      ++eq+Cy+ CnfCn +lavsvP +slf +vtvrCGhCt+l svn+a a q l+ ++          ++  +  + +++  +++  +++ + +  
  Medtr4g114730.1  12 AAEQLCYIPCNFCNIVLAVSVPCSSLFDIVTVRCGHCTNLWSVNMAAAFQSLSWQDV---------QAPSHCMNPEYRIRTSS--TPKCNDR-I 93 
                      689********************************************9999999884.........22222222222222222..2222222.2 PP

            YABBY 100 klsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                       + +  + +v++   v+rPPekrqrvPsayn+fikeeiqrika+nPdishreafs+aaknWahfP+ihfgl
  Medtr4g114730.1  94 AMRSAPTTHVTEERVVNRPPEKRQRVPSAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGL 164
                      23344445555556799****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046907.8E-7012164IPR006780YABBY protein
SuperFamilySSF470954.58E-8108157IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.101.4E-4112158IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:1902183Biological Processregulation of shoot apical meristem development
GO:2000024Biological Processregulation of leaf development
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MSSCSIDVAP AAAEQLCYIP CNFCNIVLAV SVPCSSLFDI VTVRCGHCTN LWSVNMAAAF  60
QSLSWQDVQA PSHCMNPEYR IRTSSTPKCN DRIAMRSAPT THVTEERVVN RPPEKRQRVP  120
SAYNQFIKEE IQRIKANNPD ISHREAFSTA AKNWAHFPHI HFGLMLESNN QAQIENVSEK  180
RLMSRSALMN K*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.136340.0leaf
Functional Description ? help Back to Top
Source Description
UniProtPromotes adaxial cell identity. Regulates the initiation of embryonic shoot apical meristem (SAM) development. {ECO:0000269|PubMed:19837869}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr4g114730.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0524460.0BT052446.1 Medicago truncatula clone MTYFD_FE_FF_FG1G-L-9 unknown mRNA.
GenBankBT1335810.0BT133581.1 Medicago truncatula clone JCVI-FLMt-10H8 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003609353.11e-141axial regulator YABBY 5
SwissprotQ8GW461e-87YAB5_ARATH; Axial regulator YABBY 5
TrEMBLG7JE421e-140G7JE42_MEDTR; Plant-specific transcription factor YABBY family protein
STRINGAES915501e-141(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF112434112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26580.26e-90YABBY family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]
  2. Husbands AY,Benkovics AH,Nogueira FT,Lodha M,Timmermans MC
    The ASYMMETRIC LEAVES Complex Employs Multiple Modes of Regulation to Affect Adaxial-Abaxial Patterning and Leaf Complexity.
    Plant Cell, 2015. 27(12): p. 3321-35
    [PMID:26589551]