PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr4g113140.1
Common NameMTR_4g113140
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family G2-like
Protein Properties Length: 435aa    MW: 47852 Da    PI: 6.9858
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr4g113140.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.55.4e-32235290156
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                      k+r++W+p+LH+rFv+a++ LGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Medtr4g113140.1 235 KARRCWSPDLHRRFVNALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 290
                      68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.355232292IPR017930Myb domain
SuperFamilySSF466894.66E-17232293IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.9E-28233293IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-26235290IPR006447Myb domain, plants
PfamPF002497.4E-7237288IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 435 aa     Download sequence    Send to blast
MASSSELGLD CKPHSYSMLL KSFGEQSDQS YKLEEFVSRL EEERLKIDAF KRELPLCMQL  60
LTNAMEASKQ QLQAFRSNQG AKPILEEFIP VKQLTSSETL EKTTNNNVCD MANWMTSAQL  120
WSQTSELGTK QQQNSTKENN DNNNNIGFNI SPKHRNGGAF LPFSKERNNS SCQGQGLPEL  180
ALASTQKEED KKHVGEAEKG KTNSGNEVDN QGKGSPVASS QTQTTSNNSN QTHRKARRCW  240
SPDLHRRFVN ALQMLGGSQV ATPKQIRELM KVDGLTNDEV KSHLQKYRLH TRRPSPSAQN  300
GAPAAQLVVL GGIWVPPEYA TAAHAGGTPT LYGGHPTSHH LTLPHYCTAP GQDQYYTTAP  360
PPQQLLPPPH HMHHVYKTTP HGQGSPETCG DGLDSIENGK TSESSSWKEG SSEDEGERKG  420
FVEESNGSEI TLKF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-13235288255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-13235288255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-13235288154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-13235288154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-13235288154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-13235288154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-13235288255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-13235288255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-13235288255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-13235288255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-13235288255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-13235288255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed 3 days after germination, with a gradual decrease before the floral transition and remains at low levels afterward. {ECO:0000269|PubMed:25132385}.
UniprotTISSUE SPECIFICITY: Specifically expressed in vascular tissues of cotyledons, rosette leaves and cauline leaves. Not detected in the vegetative shoot apical meristem. {ECO:0000269|PubMed:25132385}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor acting as a flowering repressor, directly repressing FT expression in a dosage-dependent manner in the leaf vasculature. {ECO:0000269|PubMed:25132385}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr4g113140.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by SVP. Down-regulated by high temperature and gibberellic acid treatment. Not regulated by photoperiod, circadian rhythm under long days or vernalization. {ECO:0000269|PubMed:25132385}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003609208.10.0myb family transcription factor EFM
SwissprotQ9ZQ851e-118EFM_ARATH; Myb family transcription factor EFM
TrEMBLG7JU630.0G7JU63_MEDTR; Myb-like transcription factor family protein
STRINGAES914050.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF54663455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-114G2-like family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]