PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr4g112380.1
Common NameMTR_4g112380, NF-YB5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family NF-YB
Protein Properties Length: 157aa    MW: 17476.9 Da    PI: 4.5183
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr4g112380.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB74.91.3e-231194386
            NF-YB  3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvy 86
                     ++d+ lP a +++i+k++lP++ ++++d+++++ ec +efi +++se+++ c re+++ti+++ +l al  lGf +y+e++ + 
  Medtr4g112380.1 11 KEDASLPKATMTKIIKEMLPQDVRVARDTQDLLIECCVEFINLISSESNEVCSREDKRTIAPEHVLKALQVLGFGEYIEEVYAA 94
                     6899***************************************************************************98654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.1E-388140IPR009072Histone-fold
SuperFamilySSF471137.42E-3512142IPR009072Histone-fold
PfamPF008082.5E-201479IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    Send to blast
MDPMDIVGKS KEDASLPKAT MTKIIKEMLP QDVRVARDTQ DLLIECCVEF INLISSESNE  60
VCSREDKRTI APEHVLKALQ VLGFGEYIEE VYAAYEQHKL ETMQDTLKAG KWSNGAEMTE  120
EQALAEQQRM FAEARARMNG GAIAPKQPDG DQNKIS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B3e-331213512133Transcription Regulator NC2 beta chain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.14480.0root
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr4g112380.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1339900.0BT133990.1 Medicago truncatula clone JCVI-FLMt-2B5 unknown mRNA.
GenBankJQ9182780.0JQ918278.1 Medicago truncatula nuclear transcription factor Y subunit B5 (NF-YB5) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003609137.11e-114protein Dr1 homolog
SwissprotP495921e-92NC2B_ARATH; Protein Dr1 homolog
TrEMBLG7JT121e-112G7JT12_MEDTR; Nuclear transcription factor Y protein
STRINGAES913341e-113(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47663358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.24e-95nuclear factor Y, subunit B13
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]
  2. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]