PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr4g111935.1
Common NameMTR_4g111935
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family TCP
Protein Properties Length: 389aa    MW: 44497.4 Da    PI: 9.3126
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr4g111935.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP130.31.9e-401312733135
              TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgt........ssssasec..eaesssssasnss 86 
                       k+drhski T++g+RdRR+Rls+e+a+rfF Lqd+LGf k+skt++WLl+q+k +ik l++         s+ss sec    +s  ++++n++
  Medtr4g111935.1 131 SKRDRHSKIKTAKGLRDRRMRLSLEVAKRFFGLQDMLGFEKASKTVDWLLNQSKLEIKLLAREknvnfptkSASSTSECteGVSSLDNEVGNQE 224
                      69****************************************************************9987666666888654455555556777 PP

              TCP  87 sgkaaksaakskksqksaasalnlakesrakarararertrekmriknk 135
                      +++++k  +k+++s+++   +++++   r+kar+rarert+ek + +++
  Medtr4g111935.1 225 EPQQQKLVMKRRNSTNKVCRKSAFNSIGREKARERARERTKEKRKARTS 273
                      77888888899999999999999999******************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036346.7E-39131269IPR005333Transcription factor, TCP
PROSITE profilePS5136931.639132190IPR017887Transcription factor TCP subgroup
PROSITE profilePS5137010.258250267IPR017888CYC/TB1, R domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000032Biological Processregulation of secondary shoot formation
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MYSSNSSLNG NNLAFSSKSP FCSFESNSTS SKDIENSHSP FPLPSPFSFF QFPNYPDDDI  60
DPFQDSHQIF LQQHDVDFQL HHPPVVMNNN STDHHQRPSN STIKANNNLL PAAAGKGKTV  120
VDQQIQRKRS SKRDRHSKIK TAKGLRDRRM RLSLEVAKRF FGLQDMLGFE KASKTVDWLL  180
NQSKLEIKLL AREKNVNFPT KSASSTSECT EGVSSLDNEV GNQEEPQQQK LVMKRRNSTN  240
KVCRKSAFNS IGREKARERA RERTKEKRKA RTSLVDESNS KQYNEEGIKT NLIWNPFESV  300
EESAGTHQST QGVTHPSFDH VKLIDEAEVE TSSQKAKEQH SDEDNSLFIM SKWSPPMMFN  360
SLNNLQQHQF EQFHQSMEKP WEAYNNRI*
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr4g111935.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013458053.10.0transcription factor DICHOTOMA
RefseqXP_024638725.10.0transcription factor DICHOTOMA
TrEMBLA0A072UQH40.0A0A072UQH4_MEDTR; Putative transcription factor TCP family
STRINGGLYMA05G07943.16e-94(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65642851
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18550.22e-19TCP family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]