PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr4g109770.1
Common NameMTR_4g109770
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family SBP
Protein Properties Length: 471aa    MW: 52323 Da    PI: 6.62
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr4g109770.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1382.7e-43123198277
                      -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
              SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                      Cqv gC++dls++k+yh+rhkvCevhsk+p v+v+g+eqrfCqqCsrfh lsefD++krsCr+rLa+hnerrrk+q
  Medtr4g109770.1 123 CQVYGCNKDLSSCKDYHKRHKVCEVHSKTPIVIVNGIEQRFCQQCSRFHLLSEFDDGKRSCRKRLAGHNERRRKPQ 198
                      **************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.1E-33118184IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.889120197IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.44E-39121198IPR004333Transcription factor, SBP-box
PfamPF031103.9E-32123196IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 471 aa     Download sequence    Send to blast
MESWSYISEE KGSEELGFCE MFGKQYSDDF NFIGNVPSKK LDGKFDDPNE FSVKGDTNFK  60
LSNSVVESNG WDSLIDLKLG RFDDHGNASI DVAFSKGAAP ILSSCESSTP PKRVRVHSMT  120
AYCQVYGCNK DLSSCKDYHK RHKVCEVHSK TPIVIVNGIE QRFCQQCSRF HLLSEFDDGK  180
RSCRKRLAGH NERRRKPQGI HSANSGRLFQ PFGDIGFQGT KPPAASFLCP EVFQSGFWRP  240
MKAEHEAGFR HLSSVPVTNG HLQSRSPFPS YNEKQFPFLH ENVATSTTGS KFSENNSHYA  300
HAIGYASLGN EDFNVFHTAP SIQGLSGISD SCALSLLSSQ SNNTSSQSSE IPFDNPLVIP  360
SSHSHVYSIR SQATSSSRVS DRFLSKLNPA DGSHLSPILV SDNNDIVNFE MEDGIFHDSD  420
FVNARDCLSC EDDATIDLLQ LSSQLQRVEH HRQSLQVKKE FDSSCTLRIT *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-281231961184squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr4g109770.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013458014.10.0putative squamosa promoter-binding-like protein 19
TrEMBLA0A072V1P80.0A0A072V1P8_MEDTR; LIGULELESS 1 protein, putative
STRINGGLYMA04G32002.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.15e-46SBP family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]