PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr4g107450.1
Common NameMTR_4g107450
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family LBD
Protein Properties Length: 300aa    MW: 33969.8 Da    PI: 5.337
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr4g107450.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260118.63.8e-37101091100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      aCaaCk++rrkC+++C lapyfpa+qpk f+nvhklFG+sn++k+lk l+++++++am+s++ +A+ r + Pv+G+++ i klq q+  +++el
  Medtr4g107450.1  10 ACAACKFQRRKCTPECLLAPYFPADQPKIFQNVHKLFGVSNIVKILKYLEPSQKKTAMDSIIIQANYRDKYPVHGCCEEICKLQYQIWMMEEEL 103
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      +++ ++
  Medtr4g107450.1 104 HAVYQQ 109
                      999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.9729110IPR004883Lateral organ boundaries, LOB
PfamPF031953.2E-3610106IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MTLKGGTTQA CAACKFQRRK CTPECLLAPY FPADQPKIFQ NVHKLFGVSN IVKILKYLEP  60
SQKKTAMDSI IIQANYRDKY PVHGCCEEIC KLQYQIWMME EELHAVYQQL EICRQQQNQQ  120
QLPHDDVTSQ LELGMATRSF NALALFNHSP QPQTYNNNNT VAASLSVSQQ HSYSNSNSVD  180
YNNSSLYMDS KDDATNPNLW LQCPYTNNNS SSIAMQPHKL VTSESQPLSS VQQGVVEDNY  240
DEMHSFFDTV DDRQSYIYSK EAYESSSEES LKDTRKCTEH VSENELKSAA ACFSLTSVN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-2961107111LOB family transfactor Ramosa2.1
5ly0_B2e-2961107111LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr4g107450.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013457865.10.0LOB domain-containing protein 27
TrEMBLA0A072URD20.0A0A072URD2_MEDTR; LOB domain protein
STRINGXP_004508794.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44152958
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.11e-46LOB domain-containing protein 27
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]