PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr4g107170.1
Common NameMTR_4g107170
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family M-type_MADS
Protein Properties Length: 256aa    MW: 29458.4 Da    PI: 5.396
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr4g107170.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF222.1e-071049241
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE- CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifs 41
                      i++   r++tf +R++g+ KK +E +   +a+++ i++ 
  Medtr4g107170.1 10 YIQSAKSRKITFKQRKQGLEKKISEFCKKSGAKACFIVYD 49
                     699999*******************************984 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006613.61148IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.06E-14179IPR002100Transcription factor, MADS-box
SMARTSM004323.0E-7160IPR002100Transcription factor, MADS-box
CDDcd002665.44E-17278No hitNo description
PfamPF003193.2E-101151IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MGRAKIPMKY IQSAKSRKIT FKQRKQGLEK KISEFCKKSG AKACFIVYDG DHNTVEPMTW  60
PEDLISVNSL LQEYQNQKIE KTPKIFDVKD YFENKKEKVE TKINKVRRDI ISNIYPTWHP  120
HFSNLDGNQL RDFIATINAK IQACNHKISM LKNMQQIETN TLDICEMIDF SDLGDFPPSS  180
PLNQLNGLVE MNDQVVNPDY TSEIVDFTSL GDLPPNSSSN QLSQHVNLND WNQLDDGVLC  240
WDCQPDEFVW KDLSF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr4g107170.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013457839.10.0agamous-like MADS-box protein AGL80
TrEMBLA0A072V1C00.0A0A072V1C0_MEDTR; MADS-box transcription factor family protein
STRINGXP_004489898.12e-74(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.11e-18M-type_MADS family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]