PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr4g095500.1
Common NameMTR_4g095500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family GRAS
Protein Properties Length: 471aa    MW: 52854.9 Da    PI: 6.1576
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr4g095500.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS303.84.2e-93574672373
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar..svselykalppsetsekn...sseelaalkl..fsevs 88 
                      ++lL++cA+a++++d +laq++L+ l+++a +dgd++qRla  f++AL +r ++  +++ l++++ +++ +  n    ++++++ +l  f++++
  Medtr4g095500.1  57 EQLLVHCANAIETNDVTLAQQILWVLNNIAPQDGDSNQRLAYSFLRALTNRAVKtgTCKMLVEQVYSNAHN--NltiDTHRFSVIELanFVDLT 148
                      79***************************************************933333444444333333..2445555556666699***** PP

             GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg........skeeleetgerLakfAeelgv 174
                      P+++f++ +aN aIlea+eg + +Hi+D++ ++++Q p+L++a+a+R e +p +++T+ ++++ +           ++ee+g++L +fA++ +v
  Medtr4g095500.1 149 PWHRFGYAAANAAILEATEGFSVIHIVDLSSTHCMQIPTLIDAIANRHEVAPLIKLTVSDHANCNsdqlippkLDLSYEELGSKLVNFARSRNV 242
                      ***********************************************************9987778899997667789**************** PP

             GRAS 175 pfefnvl...vakrledleleeLrvkp....gEalaVnlvlqlhrll......................desvsleserdevLklvkslsPkvv 239
                      ++ef+v+   +++ +++l +e+Lrv++    gEal++n++++lh+++                        +++++s r+ +L+++++l P++v
  Medtr4g095500.1 243 TLEFRVVsssYTNGFASL-IEHLRVQRlvysGEALVINCHMMLHYIPdetlsnsnsyvydsmsstttatTITTTTTSLRSLFLNALRGLDPTLV 335
                      ******966533344444.777887777777***********************************98866666666788************** PP

             GRAS 240 vvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplseka 333
                      ++v++++d++s++++ r+ +a++y +  +d++++ lpr s++r+++E+  + ++i+nv+a+eg +r+er e  +kW++r+++a F+ + ++e+ 
  Medtr4g095500.1 336 ILVDEDVDLTSNNLVSRLRSAFNYLWIPYDTVDTFLPRGSKQRQWYEAD-ICWKIENVIAHEGVQRVERVEPISKWEQRMRNANFQGIGFGEEC 428
                      *************************************************.******************************************** PP

             GRAS 334 akqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                      + ++k++l +++  g+ +++e++ +vl+Wk++++v++SaW
  Medtr4g095500.1 429 VGEVKAMLDEHA-AGWGLKKEDEHIVLTWKGHNVVFASAW 467
                      ************.999************************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.26630449IPR005202Transcription factor GRAS
PfamPF035141.5E-9057467IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 471 aa     Download sequence    Send to blast
MTQFTHSLPY LHQTTTTFSN PSSSMNKNNQ VPPDKPTKPW FPTSKALTTF GDTNCMEQLL  60
VHCANAIETN DVTLAQQILW VLNNIAPQDG DSNQRLAYSF LRALTNRAVK TGTCKMLVEQ  120
VYSNAHNNLT IDTHRFSVIE LANFVDLTPW HRFGYAAANA AILEATEGFS VIHIVDLSST  180
HCMQIPTLID AIANRHEVAP LIKLTVSDHA NCNSDQLIPP KLDLSYEELG SKLVNFARSR  240
NVTLEFRVVS SSYTNGFASL IEHLRVQRLV YSGEALVINC HMMLHYIPDE TLSNSNSYVY  300
DSMSSTTTAT TITTTTTSLR SLFLNALRGL DPTLVILVDE DVDLTSNNLV SRLRSAFNYL  360
WIPYDTVDTF LPRGSKQRQW YEADICWKIE NVIAHEGVQR VERVEPISKW EQRMRNANFQ  420
GIGFGEECVG EVKAMLDEHA AGWGLKKEDE HIVLTWKGHN VVFASAWLPA *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B4e-505746988474Protein SHORT-ROOT
5b3h_B1e-505746934420Protein SHORT-ROOT
5b3h_E1e-505746934420Protein SHORT-ROOT
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.2940.0root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, leaves and flowers. {ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr4g095500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1377030.0AC137703.43 Medicago truncatula chromosome 8 clone mth2-11d24, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024638779.10.0scarecrow-like protein 32
SwissprotQ9SN221e-170SCL32_ARATH; Scarecrow-like protein 32
TrEMBLG7JCU80.0G7JCU8_MEDTR; GRAS family transcription factor
STRINGAES906730.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77023347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-167GRAS family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]