PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr4g089095.2
Common NameMTR_4g089095
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family Dof
Protein Properties Length: 265aa    MW: 29533.9 Da    PI: 8.5539
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr4g089095.2genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof113.21.2e-351269259
           zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59
                     + ++l+cprCdstntkfCyynny+ sqPr+fC+aC+r+WtkGG+lrnvPvGggr++++
  Medtr4g089095.2 12 QAEHLNCPRCDSTNTKFCYYNNYNKSQPRHFCRACKRHWTKGGTLRNVPVGGGRKNKR 69
                     56889**********************************************9966554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-221369IPR003851Zinc finger, Dof-type
PfamPF027019.4E-321568IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.3631670IPR003851Zinc finger, Dof-type
PROSITE patternPS0136101854IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MRKQQQQQSQ QQAEHLNCPR CDSTNTKFCY YNNYNKSQPR HFCRACKRHW TKGGTLRNVP  60
VGGGRKNKRI KKPTTPVTSS TTITTTSTTC TTSITNMNSN MAIQTPLQVG DHKSIPSSLY  120
QALIHPPSLL LQQNMMNNLS ENKDFGIGNG NGNVNVNGMF TSTSSTLHLP HQNQTMLFPF  180
STSSSFDTTT CSSSNVYYYG EDFKTIEEPI IPSTGCTNTK PWEIPAASTS GGMESSKYWN  240
WEDIDSLVST DLKNPYWDDS DIKP*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.112420.0leaf| root| stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr4g089095.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1368290.0BT136829.1 Medicago truncatula clone JCVI-FLMt-15B3 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013457087.10.0dof zinc finger protein DOF1.4
TrEMBLA0A072UN400.0A0A072UN40_MEDTR; Dof domain zinc finger protein
TrEMBLA0A072UPW60.0A0A072UPW6_MEDTR; Dof domain zinc finger protein
STRINGXP_004505012.11e-102(Cicer arietinum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.22e-29Dof family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]