PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr4g088580.1
Common NameMTR_4g088580
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family Dof
Protein Properties Length: 385aa    MW: 41860.6 Da    PI: 8.3318
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr4g088580.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1244.9e-3951110261
           zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                      +++al+cprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+ 
  Medtr4g088580.1  51 QQQALRCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRL 110
                      7899******************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.7E-3353109IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.4655109IPR003851Zinc finger, Dof-type
ProDomPD0074786.0E-2756109IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105793IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MFGNCVDEKT VITCNKLTQA EIDDLKVSMA SSSGGGNRVM EKPGQELLQQ QQQALRCPRC  60
DSSNTKFCYY NNYSLSQPRH FCKACKRYWT RGGTLRNVPV GGGCRKNKRL KRPNHSSSNI  120
DTATASPSSS TPNSANSNPP SQQQQQQHHS FDIASTSNHI NSLLYGNSSC HDVMNFPFAT  180
RFNSTRVSSS SSGYDHLQQQ QPQVNGLGLG FSSGVVNLNH HDDYRNGFGS NNNNYSSIFG  240
SSSTSTNDNS MASTTPVMAS LLNSTLLQQK FMSAAGGGMK GGDPFHHEAG MMDSKEVKLG  300
EGLQNRLDQW SNNMNVPNGG VAFQNQMENM GLSDSSSLYW NNNNTNNNNN NNNNNNTAAT  360
GLSSVWNTDH QPNNIGHNSV TSLI*
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr4g088580.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0878491e-121AB087849.1 Pisum sativum PsDof4 mRNA for DNA binding with one finger 4 protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013456998.10.0dof zinc finger protein DOF1.4 isoform X1
TrEMBLA0A072UML90.0A0A072UML9_MEDTR; Dof-type zinc finger DNA-binding family protein
STRINGXP_004505077.11e-130(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45223356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.25e-35Dof family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]