PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr4g088070.1
Common NameMTR_4g088070
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family WOX
Protein Properties Length: 414aa    MW: 46433.1 Da    PI: 4.7087
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr4g088070.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox53.15.5e-172786256
                     T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHH CS
         Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakek 56
                     r+R+ +++eq+++Le+ +++  ++p  +e++++ ++l    ++ ++ V++WFqNr+ k k
  Medtr4g088070.1 27 RPRWIPKPEQIRILEAIYNSgMKNPPVDEIKKIREQLqefgQIGDASVFYWFQNRKSKGK 86
                     89*****************99*************************************98 PP

2Wus_type_Homeobox98.55.1e-322789365
  Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       r+RW P+peQi+iLe++y+sG+++P+ +ei++i+++L+e+G+i+d+ VfyWFQNrk++ ++k+
    Medtr4g088070.1 27 RPRWIPKPEQIRILEAIYNSGMKNPPVDEIKKIREQLQEFGQIGDASVFYWFQNRKSKGKNKK 89
                       79*********************************************************9996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.55E-122388IPR009057Homeodomain-like
PROSITE profilePS5007110.2522388IPR001356Homeobox domain
SMARTSM003895.4E-72592IPR001356Homeobox domain
CDDcd000861.13E-62689No hitNo description
Gene3DG3DSA:1.10.10.601.7E-72691IPR009057Homeodomain-like
PfamPF000461.3E-142786IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
MAPRKKVHWP SRFIKSTSDE DRNPGPRPRW IPKPEQIRIL EAIYNSGMKN PPVDEIKKIR  60
EQLQEFGQIG DASVFYWFQN RKSKGKNKKA PYPKKSKRQP IADPALNNSL PQITTPPPNS  120
SSSSSSNNII GISNINDGTV MVPNSPAISL NQNQDDTYPD TLAETGLQLP TPPFPSFPVE  180
NHINERVVLN DMTTLEGSNY FSDFPNMIEP SPQQNVDLPL LNYDNIMNNE NENGIYSVHD  240
LFYQENIQEE AMNMMHMHQQ DPQFNFGVTT TSSNDDSTDL APLPPAIDMS APVDVPFLFT  300
GDQLQGFGEE DGMKKCRVFT TNEVIEVNAG PFNVRESFGN RAVLFDSFST PVLTDEWGVT  360
LNSLYHGADY YLSDGQLINK RLIAIIAKFN ILSSLQLTYQ HAVELILSKI AYS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr4g088070.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024636460.10.0WUSCHEL-related homeobox 9
TrEMBLA0A072UNJ40.0A0A072UNJ4_MEDTR; Wuschel homeobox protein
STRINGAES781361e-132(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38243361
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.14e-28homeobox-3
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]